Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MVK7

Protein Details
Accession A0A1Y3MVK7    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
90-109ELSKKEKSKVEKIINKKFNKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 8, golg 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036779  LysM_dom_sf  
IPR036444  PLipase_A2_dom_sf  
Gene Ontology GO:0004623  F:phospholipase A2 activity  
GO:0050482  P:arachidonic acid secretion  
GO:0006644  P:phospholipid metabolic process  
Amino Acid Sequences MGLYKNLFCLALLSLSLAEPIDNCSEYYKVGKNESILDIANKHKLPATALFYFNDNKLNEIKENQVICINKEVDMLKYLEVMVNHSELQELSKKEKSKVEKIINKKFNKDEIEELNQTSDFASLSFNKVFESNLFNKFDLNKCERGCSNAQKIFNEINKSEDNLLSVSTINNIAEDVNTDFKIKNNTLYQNCLDFCYTNNFIQQYREEKEEAEEFVEIESIPEKNKFEKRGCSGPSRKGTEKIGDLKVSRYYDNNELLKAGRIDGCSAPFEVLKIDIFKPACNAHYYCYHCSSSKSQCDSTLYSQLKTICKEKYLSLGFDNLFNGYKNYGTCMTEALGYYLAVVDFGEGGYNSDRGWVEGKNNSDCVCSNACISNFMNQPFYTEKDKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.09
5 0.08
6 0.07
7 0.1
8 0.13
9 0.13
10 0.13
11 0.15
12 0.16
13 0.18
14 0.23
15 0.26
16 0.27
17 0.31
18 0.33
19 0.32
20 0.36
21 0.36
22 0.33
23 0.28
24 0.26
25 0.26
26 0.27
27 0.33
28 0.28
29 0.27
30 0.28
31 0.28
32 0.29
33 0.32
34 0.34
35 0.31
36 0.33
37 0.33
38 0.32
39 0.34
40 0.32
41 0.31
42 0.25
43 0.23
44 0.25
45 0.27
46 0.27
47 0.27
48 0.3
49 0.3
50 0.31
51 0.3
52 0.32
53 0.3
54 0.28
55 0.33
56 0.29
57 0.23
58 0.25
59 0.25
60 0.21
61 0.23
62 0.22
63 0.15
64 0.15
65 0.15
66 0.14
67 0.13
68 0.14
69 0.13
70 0.13
71 0.13
72 0.13
73 0.13
74 0.11
75 0.14
76 0.17
77 0.17
78 0.21
79 0.27
80 0.3
81 0.34
82 0.41
83 0.45
84 0.49
85 0.57
86 0.62
87 0.65
88 0.72
89 0.79
90 0.81
91 0.78
92 0.76
93 0.7
94 0.67
95 0.63
96 0.56
97 0.5
98 0.47
99 0.49
100 0.44
101 0.4
102 0.34
103 0.29
104 0.26
105 0.21
106 0.15
107 0.08
108 0.07
109 0.09
110 0.08
111 0.12
112 0.13
113 0.12
114 0.13
115 0.13
116 0.13
117 0.13
118 0.18
119 0.19
120 0.24
121 0.26
122 0.25
123 0.27
124 0.29
125 0.32
126 0.32
127 0.33
128 0.34
129 0.32
130 0.35
131 0.34
132 0.36
133 0.38
134 0.39
135 0.43
136 0.42
137 0.44
138 0.4
139 0.44
140 0.44
141 0.41
142 0.38
143 0.29
144 0.28
145 0.26
146 0.27
147 0.25
148 0.2
149 0.17
150 0.13
151 0.13
152 0.09
153 0.09
154 0.08
155 0.07
156 0.07
157 0.06
158 0.06
159 0.06
160 0.05
161 0.05
162 0.06
163 0.07
164 0.08
165 0.08
166 0.09
167 0.09
168 0.11
169 0.16
170 0.15
171 0.18
172 0.21
173 0.27
174 0.28
175 0.31
176 0.31
177 0.29
178 0.29
179 0.26
180 0.22
181 0.16
182 0.15
183 0.17
184 0.18
185 0.16
186 0.17
187 0.17
188 0.17
189 0.19
190 0.21
191 0.21
192 0.21
193 0.22
194 0.21
195 0.2
196 0.21
197 0.21
198 0.18
199 0.14
200 0.11
201 0.09
202 0.09
203 0.09
204 0.06
205 0.05
206 0.06
207 0.05
208 0.06
209 0.08
210 0.09
211 0.15
212 0.2
213 0.27
214 0.3
215 0.36
216 0.41
217 0.46
218 0.49
219 0.53
220 0.54
221 0.57
222 0.6
223 0.59
224 0.57
225 0.52
226 0.52
227 0.46
228 0.45
229 0.43
230 0.39
231 0.36
232 0.34
233 0.33
234 0.35
235 0.33
236 0.28
237 0.24
238 0.25
239 0.27
240 0.32
241 0.31
242 0.26
243 0.25
244 0.25
245 0.25
246 0.22
247 0.18
248 0.14
249 0.13
250 0.15
251 0.16
252 0.17
253 0.15
254 0.15
255 0.15
256 0.12
257 0.12
258 0.1
259 0.1
260 0.09
261 0.11
262 0.11
263 0.15
264 0.16
265 0.16
266 0.19
267 0.2
268 0.2
269 0.21
270 0.22
271 0.19
272 0.27
273 0.32
274 0.33
275 0.36
276 0.37
277 0.34
278 0.37
279 0.42
280 0.43
281 0.47
282 0.48
283 0.44
284 0.45
285 0.48
286 0.48
287 0.46
288 0.46
289 0.39
290 0.35
291 0.36
292 0.38
293 0.38
294 0.37
295 0.38
296 0.31
297 0.32
298 0.34
299 0.32
300 0.36
301 0.36
302 0.35
303 0.31
304 0.34
305 0.31
306 0.3
307 0.3
308 0.22
309 0.2
310 0.18
311 0.17
312 0.13
313 0.15
314 0.13
315 0.16
316 0.18
317 0.18
318 0.18
319 0.18
320 0.17
321 0.17
322 0.17
323 0.15
324 0.13
325 0.11
326 0.11
327 0.1
328 0.09
329 0.07
330 0.06
331 0.05
332 0.05
333 0.05
334 0.06
335 0.05
336 0.07
337 0.09
338 0.09
339 0.09
340 0.13
341 0.13
342 0.14
343 0.16
344 0.17
345 0.21
346 0.26
347 0.32
348 0.32
349 0.35
350 0.34
351 0.34
352 0.33
353 0.32
354 0.3
355 0.26
356 0.25
357 0.28
358 0.27
359 0.3
360 0.3
361 0.33
362 0.34
363 0.35
364 0.37
365 0.31
366 0.34
367 0.33
368 0.36