Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NHU4

Protein Details
Accession A0A1Y3NHU4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
73-100LKNGVKGRANRMRRRRRNREPLKTQEELBasic
NLS Segment(s)
PositionSequence
77-92VKGRANRMRRRRRNRE
Subcellular Location(s) nucl 14, cyto_nucl 12, cyto 8, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MGQQQDLFKDIGPVKTAAINFLPNGKSKGTGQVVFVRSNDANRAIKKYNNVELDGRPMKIEMVLSSSAALNALKNGVKGRANRMRRRRRNREPLKTQEELDAEMDTYMKVDDMNVQPQSNADGNTSNAAVIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.25
4 0.21
5 0.2
6 0.19
7 0.17
8 0.22
9 0.22
10 0.2
11 0.23
12 0.21
13 0.21
14 0.21
15 0.28
16 0.28
17 0.28
18 0.28
19 0.34
20 0.35
21 0.35
22 0.34
23 0.3
24 0.26
25 0.26
26 0.25
27 0.23
28 0.25
29 0.25
30 0.3
31 0.28
32 0.31
33 0.35
34 0.38
35 0.39
36 0.37
37 0.38
38 0.35
39 0.33
40 0.38
41 0.34
42 0.29
43 0.22
44 0.19
45 0.17
46 0.15
47 0.14
48 0.07
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.07
55 0.07
56 0.07
57 0.04
58 0.04
59 0.06
60 0.06
61 0.07
62 0.08
63 0.1
64 0.14
65 0.16
66 0.25
67 0.33
68 0.41
69 0.5
70 0.61
71 0.69
72 0.76
73 0.86
74 0.88
75 0.9
76 0.92
77 0.94
78 0.94
79 0.92
80 0.91
81 0.87
82 0.79
83 0.69
84 0.62
85 0.52
86 0.43
87 0.34
88 0.24
89 0.17
90 0.15
91 0.14
92 0.09
93 0.08
94 0.06
95 0.05
96 0.05
97 0.05
98 0.11
99 0.14
100 0.21
101 0.23
102 0.23
103 0.23
104 0.24
105 0.28
106 0.24
107 0.22
108 0.17
109 0.17
110 0.18
111 0.2
112 0.2