Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZU78

Protein Details
Accession G8ZU78    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-44NEPSKEKKPEAGEKKQKNKRRRRNYDEYDAEVBasic
NLS Segment(s)
PositionSequence
13-35NEPSKEKKPEAGEKKQKNKRRRR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019098  Histone_chaperone_domain_CHZ  
Gene Ontology GO:0005634  C:nucleus  
KEGG tdl:TDEL_0D05880  -  
Pfam View protein in Pfam  
PF09649  CHZ  
Amino Acid Sequences MSEEAKDKRPLENEPSKEKKPEAGEKKQKNKRRRRNYDEYDAEVAQEEKTAKAAHGKSKQDEEEESDLDDAKLDAMVDQEEAEDDLAEIDTSNIITGGRRTRGKVIDYKKTAAEMEKQKIPADENDEDDVDDDFKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.63
4 0.64
5 0.6
6 0.57
7 0.55
8 0.59
9 0.58
10 0.62
11 0.68
12 0.74
13 0.83
14 0.86
15 0.87
16 0.88
17 0.89
18 0.89
19 0.9
20 0.91
21 0.9
22 0.91
23 0.9
24 0.9
25 0.83
26 0.77
27 0.69
28 0.58
29 0.48
30 0.38
31 0.3
32 0.19
33 0.16
34 0.11
35 0.08
36 0.09
37 0.09
38 0.09
39 0.15
40 0.18
41 0.24
42 0.32
43 0.35
44 0.36
45 0.4
46 0.41
47 0.36
48 0.34
49 0.31
50 0.26
51 0.22
52 0.2
53 0.16
54 0.15
55 0.13
56 0.12
57 0.07
58 0.04
59 0.04
60 0.03
61 0.03
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.03
72 0.03
73 0.04
74 0.04
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.08
84 0.12
85 0.18
86 0.2
87 0.23
88 0.29
89 0.33
90 0.37
91 0.43
92 0.46
93 0.51
94 0.53
95 0.53
96 0.48
97 0.46
98 0.43
99 0.37
100 0.38
101 0.37
102 0.38
103 0.41
104 0.42
105 0.41
106 0.41
107 0.41
108 0.37
109 0.36
110 0.33
111 0.32
112 0.33
113 0.32
114 0.3
115 0.28
116 0.24