Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MTU7

Protein Details
Accession A0A1Y3MTU7    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
33-57ITTTQIKKYYQPKRNKPTKYTRELSHydrophilic
123-147YQNKYKYSDGNIKKKRKEKQRGKIIHydrophilic
NLS Segment(s)
PositionSequence
135-147KKKRKEKQRGKII
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF12874  zf-met  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MNPPPLSLSLPPSSPSPPPSTTTTFIGDTTTTITTTQIKKYYQPKRNKPTKYTRELSTKPFKIDCFCEICCKVFSRKYDRDRHYRIHLNKLPYSCKVCGAKFIRSDYVINHIRNTPCGQADYYQNKYKYSDGNIKKKRKEKQRGKII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.3
4 0.3
5 0.32
6 0.36
7 0.39
8 0.39
9 0.39
10 0.37
11 0.33
12 0.3
13 0.28
14 0.22
15 0.17
16 0.17
17 0.15
18 0.12
19 0.11
20 0.12
21 0.16
22 0.19
23 0.24
24 0.25
25 0.26
26 0.33
27 0.42
28 0.51
29 0.55
30 0.63
31 0.69
32 0.75
33 0.83
34 0.84
35 0.83
36 0.84
37 0.84
38 0.82
39 0.76
40 0.71
41 0.7
42 0.65
43 0.64
44 0.63
45 0.56
46 0.5
47 0.48
48 0.43
49 0.37
50 0.36
51 0.32
52 0.26
53 0.24
54 0.27
55 0.26
56 0.26
57 0.25
58 0.23
59 0.24
60 0.24
61 0.29
62 0.32
63 0.4
64 0.47
65 0.56
66 0.59
67 0.65
68 0.66
69 0.66
70 0.64
71 0.65
72 0.6
73 0.61
74 0.6
75 0.56
76 0.54
77 0.53
78 0.49
79 0.44
80 0.45
81 0.35
82 0.36
83 0.35
84 0.31
85 0.37
86 0.38
87 0.39
88 0.38
89 0.41
90 0.38
91 0.35
92 0.36
93 0.28
94 0.32
95 0.33
96 0.3
97 0.29
98 0.31
99 0.3
100 0.33
101 0.34
102 0.29
103 0.24
104 0.25
105 0.24
106 0.22
107 0.3
108 0.35
109 0.39
110 0.43
111 0.43
112 0.43
113 0.44
114 0.45
115 0.41
116 0.41
117 0.45
118 0.47
119 0.57
120 0.66
121 0.73
122 0.79
123 0.83
124 0.85
125 0.86
126 0.88
127 0.88