Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NZ82

Protein Details
Accession A0A1Y3NZ82    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
76-99PPPPPPPPPSKRPPPPPPPPTKTTHydrophilic
NLS Segment(s)
PositionSequence
66-107KRGPPKGPGGPPPPPPPPPSKRPPPPPPPPTKTTKAKTTTTK
Subcellular Location(s) extr 14, mito 7, cyto 3.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035971  CBD_sf  
IPR000254  Cellulose-bd_dom_fun  
Gene Ontology GO:0005576  C:extracellular region  
GO:0030248  F:cellulose binding  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF00734  CBM_1  
PROSITE View protein in PROSITE  
PS51164  CBM1_2  
Amino Acid Sequences MQIKKILLICSSVAGLANAACSGASAQCGGVDYQGENCCIGGYSCEYVNEWYSECVPINENGSLIKRGPPKGPGGPPPPPPPPPSKRPPPPPPPPTKTTKAKTTTTKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.07
5 0.06
6 0.06
7 0.05
8 0.05
9 0.05
10 0.05
11 0.06
12 0.05
13 0.06
14 0.06
15 0.07
16 0.07
17 0.07
18 0.07
19 0.07
20 0.11
21 0.12
22 0.12
23 0.11
24 0.11
25 0.11
26 0.1
27 0.1
28 0.07
29 0.07
30 0.08
31 0.08
32 0.09
33 0.09
34 0.1
35 0.11
36 0.1
37 0.09
38 0.09
39 0.09
40 0.1
41 0.09
42 0.09
43 0.09
44 0.09
45 0.11
46 0.1
47 0.1
48 0.1
49 0.11
50 0.12
51 0.11
52 0.16
53 0.18
54 0.21
55 0.23
56 0.25
57 0.28
58 0.33
59 0.38
60 0.4
61 0.42
62 0.45
63 0.49
64 0.52
65 0.53
66 0.5
67 0.49
68 0.51
69 0.51
70 0.54
71 0.57
72 0.62
73 0.66
74 0.73
75 0.79
76 0.8
77 0.84
78 0.86
79 0.88
80 0.84
81 0.8
82 0.77
83 0.76
84 0.76
85 0.72
86 0.71
87 0.67
88 0.68