Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NLT8

Protein Details
Accession A0A1Y3NLT8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-35QMDYIKKKTKVSKGKGKNPKWNDLLHydrophilic
NLS Segment(s)
PositionSequence
16-29KKKTKVSKGKGKNP
Subcellular Location(s) cyto 12, cyto_nucl 11, nucl 8, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000008  C2_dom  
IPR035892  C2_domain_sf  
Pfam View protein in Pfam  
PF00168  C2  
PROSITE View protein in PROSITE  
PS50004  C2  
Amino Acid Sequences MFSVTPYISFQMDYIKKKTKVSKGKGKNPKWNDLLEFEIIKGRDILNGKVMGKEISEDEYIGDIKVDLKPIFQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.42
3 0.44
4 0.51
5 0.59
6 0.6
7 0.64
8 0.69
9 0.73
10 0.74
11 0.82
12 0.86
13 0.86
14 0.86
15 0.81
16 0.8
17 0.72
18 0.64
19 0.56
20 0.48
21 0.41
22 0.32
23 0.27
24 0.19
25 0.18
26 0.16
27 0.14
28 0.12
29 0.09
30 0.11
31 0.13
32 0.14
33 0.14
34 0.17
35 0.17
36 0.18
37 0.18
38 0.15
39 0.14
40 0.14
41 0.11
42 0.12
43 0.12
44 0.11
45 0.11
46 0.12
47 0.12
48 0.11
49 0.1
50 0.07
51 0.09
52 0.1
53 0.15
54 0.13