Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NA06

Protein Details
Accession A0A1Y3NA06    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
14-36VTKNEKFTKRRTQEQQQQRDENDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009445  TMEM85/Emc4  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF06417  DUF1077  
Amino Acid Sequences RIKANSAIPAGFVVTKNEKFTKRRTQEQQQQRDENDLKTLKVKVRAYEKAFNSVKGIFMNVIMMFMSGNSINQFTIIIVGMLFSNPIKALKQTNEGIVIVSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.28
4 0.34
5 0.39
6 0.41
7 0.49
8 0.55
9 0.56
10 0.64
11 0.68
12 0.73
13 0.76
14 0.83
15 0.85
16 0.82
17 0.8
18 0.71
19 0.7
20 0.61
21 0.52
22 0.48
23 0.38
24 0.31
25 0.28
26 0.3
27 0.25
28 0.31
29 0.32
30 0.3
31 0.36
32 0.42
33 0.44
34 0.48
35 0.46
36 0.47
37 0.45
38 0.41
39 0.36
40 0.29
41 0.25
42 0.18
43 0.17
44 0.09
45 0.08
46 0.09
47 0.07
48 0.06
49 0.05
50 0.05
51 0.04
52 0.04
53 0.05
54 0.04
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.07
61 0.05
62 0.06
63 0.06
64 0.05
65 0.04
66 0.05
67 0.05
68 0.05
69 0.05
70 0.04
71 0.05
72 0.06
73 0.08
74 0.09
75 0.12
76 0.18
77 0.21
78 0.28
79 0.29
80 0.31
81 0.32
82 0.31
83 0.3