Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3MS62

Protein Details
Accession A0A1Y3MS62    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
75-99FQILRDHRKIRQREKEKKAAKEALRBasic
NLS Segment(s)
PositionSequence
81-97HRKIRQREKEKKAAKEA
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MEIKGLINETNKIIQSQQEKLENEYNTISAIPKSEESTMVIIKKNVKPFVVNNMVFPFLQGFASKLASLYLFRTFQILRDHRKIRQREKEKKAAKEALRVQRRQQYSSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.3
4 0.33
5 0.36
6 0.37
7 0.41
8 0.46
9 0.41
10 0.38
11 0.34
12 0.28
13 0.22
14 0.21
15 0.17
16 0.11
17 0.11
18 0.11
19 0.11
20 0.13
21 0.13
22 0.13
23 0.14
24 0.15
25 0.16
26 0.17
27 0.17
28 0.17
29 0.23
30 0.26
31 0.3
32 0.29
33 0.28
34 0.28
35 0.28
36 0.34
37 0.36
38 0.32
39 0.28
40 0.27
41 0.28
42 0.25
43 0.24
44 0.16
45 0.08
46 0.08
47 0.07
48 0.07
49 0.07
50 0.08
51 0.08
52 0.07
53 0.07
54 0.07
55 0.08
56 0.09
57 0.11
58 0.11
59 0.11
60 0.14
61 0.14
62 0.17
63 0.26
64 0.3
65 0.34
66 0.43
67 0.47
68 0.51
69 0.6
70 0.66
71 0.67
72 0.72
73 0.76
74 0.78
75 0.83
76 0.87
77 0.87
78 0.86
79 0.84
80 0.82
81 0.76
82 0.74
83 0.75
84 0.75
85 0.76
86 0.72
87 0.7
88 0.7
89 0.71