Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NPX5

Protein Details
Accession A0A1Y3NPX5    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
155-210SVGDKMKKKEREMKKKTREMQKREYELVKELEKLRRQNEKERKKRRELERTEEYKYBasic
NLS Segment(s)
PositionSequence
159-200KMKKKEREMKKKTREMQKREYELVKELEKLRRQNEKERKKRR
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MADYLDLVGNVSSIFSYCSKLNESFIRYKNHAKYLNDLALQLDSIYKLSENQTLLSEKEYNYTKDKNKESSNGVNPFANYKSEMESAIPPVIIHFYNYTKKFMSHVKKIKSKNFVERLWYLSINDEKMDGTQKDTSASTTNLNKDLSQTQSREESVGDKMKKKEREMKKKTREMQKREYELVKELEKLRRQNEKERKKRRELERTEEYKYYKDILENDEKLYKKMLVRVPITSDNTNNSLSASKSQNLESIENLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.11
4 0.12
5 0.16
6 0.2
7 0.21
8 0.26
9 0.3
10 0.35
11 0.41
12 0.46
13 0.5
14 0.5
15 0.58
16 0.6
17 0.63
18 0.64
19 0.57
20 0.58
21 0.58
22 0.59
23 0.51
24 0.44
25 0.36
26 0.29
27 0.27
28 0.21
29 0.14
30 0.08
31 0.08
32 0.08
33 0.07
34 0.09
35 0.11
36 0.15
37 0.15
38 0.16
39 0.18
40 0.2
41 0.2
42 0.21
43 0.21
44 0.17
45 0.21
46 0.23
47 0.24
48 0.27
49 0.34
50 0.38
51 0.44
52 0.49
53 0.51
54 0.53
55 0.55
56 0.56
57 0.57
58 0.59
59 0.54
60 0.5
61 0.45
62 0.4
63 0.38
64 0.33
65 0.26
66 0.19
67 0.16
68 0.17
69 0.17
70 0.17
71 0.16
72 0.16
73 0.16
74 0.15
75 0.14
76 0.1
77 0.1
78 0.11
79 0.09
80 0.09
81 0.09
82 0.13
83 0.2
84 0.22
85 0.24
86 0.23
87 0.23
88 0.25
89 0.32
90 0.36
91 0.39
92 0.45
93 0.51
94 0.58
95 0.65
96 0.69
97 0.69
98 0.66
99 0.66
100 0.65
101 0.58
102 0.55
103 0.5
104 0.46
105 0.39
106 0.35
107 0.25
108 0.21
109 0.21
110 0.17
111 0.15
112 0.12
113 0.09
114 0.1
115 0.13
116 0.1
117 0.12
118 0.12
119 0.13
120 0.14
121 0.14
122 0.14
123 0.13
124 0.14
125 0.15
126 0.17
127 0.19
128 0.2
129 0.2
130 0.19
131 0.19
132 0.21
133 0.22
134 0.22
135 0.22
136 0.21
137 0.23
138 0.23
139 0.22
140 0.19
141 0.17
142 0.17
143 0.24
144 0.25
145 0.28
146 0.33
147 0.4
148 0.45
149 0.49
150 0.55
151 0.59
152 0.67
153 0.72
154 0.78
155 0.81
156 0.85
157 0.87
158 0.88
159 0.87
160 0.84
161 0.84
162 0.82
163 0.78
164 0.73
165 0.68
166 0.59
167 0.53
168 0.48
169 0.39
170 0.33
171 0.33
172 0.36
173 0.38
174 0.42
175 0.44
176 0.51
177 0.54
178 0.62
179 0.68
180 0.71
181 0.76
182 0.82
183 0.85
184 0.85
185 0.9
186 0.9
187 0.9
188 0.87
189 0.85
190 0.85
191 0.81
192 0.75
193 0.71
194 0.63
195 0.54
196 0.47
197 0.41
198 0.32
199 0.29
200 0.28
201 0.3
202 0.36
203 0.36
204 0.37
205 0.41
206 0.4
207 0.37
208 0.37
209 0.34
210 0.28
211 0.34
212 0.36
213 0.38
214 0.4
215 0.42
216 0.46
217 0.49
218 0.51
219 0.47
220 0.44
221 0.4
222 0.4
223 0.38
224 0.32
225 0.26
226 0.23
227 0.22
228 0.25
229 0.25
230 0.26
231 0.27
232 0.28
233 0.31
234 0.33
235 0.33