Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N6D3

Protein Details
Accession A0A1Y3N6D3   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
56-89EYYQKILKEKLKKKAKRLKRKKRRERRRRRRRKABasic
NLS Segment(s)
PositionSequence
63-89KEKLKKKAKRLKRKKRRERRRRRRRKA
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences KCDICKKIFSRYYDLIRHRRIHTGETPYKCVICGKGFSRSDHRDRHVFTTLCGKTEYYQKILKEKLKKKAKRLKRKKRRERRRRRRRKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.66
3 0.67
4 0.68
5 0.63
6 0.63
7 0.58
8 0.55
9 0.53
10 0.54
11 0.54
12 0.52
13 0.54
14 0.48
15 0.45
16 0.4
17 0.34
18 0.28
19 0.22
20 0.22
21 0.2
22 0.27
23 0.29
24 0.31
25 0.38
26 0.41
27 0.45
28 0.46
29 0.47
30 0.43
31 0.43
32 0.45
33 0.43
34 0.37
35 0.32
36 0.36
37 0.33
38 0.3
39 0.28
40 0.24
41 0.19
42 0.27
43 0.29
44 0.23
45 0.27
46 0.28
47 0.34
48 0.4
49 0.46
50 0.48
51 0.54
52 0.6
53 0.67
54 0.72
55 0.77
56 0.81
57 0.85
58 0.86
59 0.89
60 0.91
61 0.91
62 0.95
63 0.96
64 0.97
65 0.97
66 0.97
67 0.97
68 0.97
69 0.97