Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MUG0

Protein Details
Accession A0A1Y3MUG0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
162-190KHPQQIRYVEREKKKEKKRKNIYIYILNKHydrophilic
NLS Segment(s)
PositionSequence
172-181REKKKEKKRK
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 4, cyto 4, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
IPR000225  Armadillo  
Pfam View protein in Pfam  
PF00514  Arm  
Amino Acid Sequences LAPAFPILRQSIYFEDPAILSETCWALSRIFHGSHPKVTYLLDLELCQRLVELLKHDSISVVNPVLRTLTNIAYGDDQQTQLIINAGAIPILYELLASPNASIRLETILVLANITAGTVAQIQSVIDAGCINRLFEILSNTKESLKIRKEACWAISNATDVKHPQQIRYVEREKKKEKKRKNIYIYILNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.19
4 0.2
5 0.19
6 0.14
7 0.11
8 0.13
9 0.13
10 0.12
11 0.13
12 0.13
13 0.11
14 0.11
15 0.14
16 0.17
17 0.17
18 0.21
19 0.29
20 0.31
21 0.36
22 0.37
23 0.35
24 0.32
25 0.31
26 0.29
27 0.22
28 0.21
29 0.16
30 0.14
31 0.16
32 0.16
33 0.16
34 0.14
35 0.11
36 0.1
37 0.11
38 0.12
39 0.13
40 0.14
41 0.15
42 0.16
43 0.16
44 0.15
45 0.14
46 0.14
47 0.12
48 0.11
49 0.1
50 0.1
51 0.1
52 0.11
53 0.1
54 0.11
55 0.11
56 0.11
57 0.12
58 0.12
59 0.13
60 0.13
61 0.14
62 0.14
63 0.13
64 0.12
65 0.09
66 0.09
67 0.08
68 0.07
69 0.07
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.02
81 0.02
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.06
88 0.06
89 0.06
90 0.06
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.06
99 0.05
100 0.04
101 0.04
102 0.03
103 0.02
104 0.03
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.04
113 0.04
114 0.04
115 0.04
116 0.08
117 0.08
118 0.08
119 0.08
120 0.08
121 0.08
122 0.09
123 0.14
124 0.13
125 0.15
126 0.18
127 0.19
128 0.2
129 0.23
130 0.24
131 0.28
132 0.29
133 0.34
134 0.34
135 0.38
136 0.43
137 0.44
138 0.45
139 0.41
140 0.38
141 0.34
142 0.34
143 0.31
144 0.27
145 0.23
146 0.22
147 0.2
148 0.22
149 0.27
150 0.27
151 0.27
152 0.33
153 0.4
154 0.43
155 0.49
156 0.55
157 0.56
158 0.64
159 0.72
160 0.75
161 0.78
162 0.84
163 0.86
164 0.88
165 0.9
166 0.92
167 0.93
168 0.93
169 0.92
170 0.89