Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZLP2

Protein Details
Accession G8ZLP2   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-38WKIPWRMSSHQKQRVRHRLRDVHydrophilic
100-130TVFNRKSKDYRKSVHKVPKWTKLSLRRNPKFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2.5, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG tdl:TDEL_0A02040  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFKASNTLLGGLLWKIPWRMSSHQKQRVRHRLRDVDEVLKQVNLGLHVERCQQKGMQFQEALETPKMFKPRIKSLRLLNKPSIFPKENQMSPKDKYTVFNRKSKDYRKSVHKVPKWTKLSLRRNPKFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.12
4 0.12
5 0.11
6 0.12
7 0.15
8 0.19
9 0.26
10 0.35
11 0.45
12 0.54
13 0.63
14 0.69
15 0.74
16 0.8
17 0.84
18 0.83
19 0.81
20 0.8
21 0.79
22 0.76
23 0.76
24 0.69
25 0.64
26 0.57
27 0.5
28 0.41
29 0.31
30 0.26
31 0.19
32 0.16
33 0.11
34 0.1
35 0.09
36 0.09
37 0.11
38 0.16
39 0.18
40 0.19
41 0.19
42 0.19
43 0.21
44 0.27
45 0.29
46 0.27
47 0.25
48 0.24
49 0.24
50 0.24
51 0.24
52 0.17
53 0.15
54 0.12
55 0.14
56 0.17
57 0.16
58 0.17
59 0.21
60 0.31
61 0.39
62 0.41
63 0.43
64 0.49
65 0.59
66 0.64
67 0.63
68 0.59
69 0.55
70 0.54
71 0.53
72 0.52
73 0.43
74 0.37
75 0.4
76 0.4
77 0.4
78 0.41
79 0.42
80 0.41
81 0.41
82 0.45
83 0.4
84 0.36
85 0.36
86 0.42
87 0.48
88 0.48
89 0.52
90 0.51
91 0.57
92 0.65
93 0.7
94 0.7
95 0.68
96 0.71
97 0.74
98 0.78
99 0.79
100 0.81
101 0.78
102 0.8
103 0.8
104 0.82
105 0.77
106 0.75
107 0.75
108 0.75
109 0.79
110 0.78
111 0.8