Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3MUK2

Protein Details
Accession A0A1Y3MUK2    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
222-241NPKDKSYKKSYKYSSILKKFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 12.333, cyto 9, cyto_mito 6.999, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001223  Glyco_hydro18_cat  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0016787  F:hydrolase activity  
GO:0005975  P:carbohydrate metabolic process  
PROSITE View protein in PROSITE  
PS51910  GH18_2  
Amino Acid Sequences KKDGGRVIISFGGAFNDELALHHDSASSLAKEYKKVIEKYQPIRIDFDMEGTGLDDNVAKGRKAEEVHKLRAQALNIVRKELKDKMPSISLCLPVNPDVGFNDSALAVIKAMKNENVPIDNINIMAMDYGSYYKSRGFYENTINSLEKSYEQSRSIYPDVKMGVIPMIGQNDDGAILTLQDAERIVDYLKSKKYVNTVSMWSINRDKNDGEFSSLVKNTFINPKDKSYKKSYKYSSILKKFLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.09
4 0.08
5 0.09
6 0.12
7 0.14
8 0.13
9 0.13
10 0.13
11 0.13
12 0.15
13 0.18
14 0.14
15 0.13
16 0.19
17 0.21
18 0.23
19 0.26
20 0.31
21 0.36
22 0.39
23 0.44
24 0.48
25 0.56
26 0.6
27 0.66
28 0.64
29 0.57
30 0.58
31 0.52
32 0.46
33 0.37
34 0.32
35 0.24
36 0.18
37 0.16
38 0.13
39 0.12
40 0.07
41 0.08
42 0.06
43 0.05
44 0.09
45 0.11
46 0.1
47 0.11
48 0.12
49 0.16
50 0.18
51 0.23
52 0.29
53 0.35
54 0.41
55 0.43
56 0.43
57 0.41
58 0.42
59 0.38
60 0.34
61 0.34
62 0.36
63 0.33
64 0.35
65 0.34
66 0.31
67 0.35
68 0.33
69 0.34
70 0.31
71 0.32
72 0.32
73 0.36
74 0.36
75 0.37
76 0.34
77 0.31
78 0.26
79 0.24
80 0.23
81 0.18
82 0.19
83 0.14
84 0.12
85 0.1
86 0.12
87 0.12
88 0.1
89 0.09
90 0.08
91 0.08
92 0.08
93 0.07
94 0.05
95 0.06
96 0.07
97 0.07
98 0.08
99 0.09
100 0.09
101 0.11
102 0.12
103 0.11
104 0.11
105 0.11
106 0.11
107 0.1
108 0.09
109 0.08
110 0.06
111 0.05
112 0.05
113 0.04
114 0.03
115 0.03
116 0.04
117 0.04
118 0.05
119 0.06
120 0.07
121 0.09
122 0.1
123 0.13
124 0.15
125 0.18
126 0.26
127 0.27
128 0.28
129 0.28
130 0.27
131 0.25
132 0.23
133 0.21
134 0.14
135 0.16
136 0.17
137 0.18
138 0.19
139 0.2
140 0.2
141 0.25
142 0.27
143 0.26
144 0.23
145 0.23
146 0.23
147 0.21
148 0.2
149 0.15
150 0.13
151 0.09
152 0.09
153 0.08
154 0.08
155 0.08
156 0.08
157 0.07
158 0.06
159 0.07
160 0.06
161 0.05
162 0.04
163 0.04
164 0.04
165 0.05
166 0.05
167 0.06
168 0.06
169 0.06
170 0.06
171 0.07
172 0.07
173 0.09
174 0.13
175 0.18
176 0.21
177 0.24
178 0.25
179 0.27
180 0.34
181 0.36
182 0.37
183 0.35
184 0.35
185 0.37
186 0.42
187 0.4
188 0.38
189 0.39
190 0.39
191 0.38
192 0.37
193 0.34
194 0.31
195 0.36
196 0.32
197 0.3
198 0.27
199 0.26
200 0.3
201 0.31
202 0.28
203 0.23
204 0.22
205 0.21
206 0.29
207 0.31
208 0.31
209 0.33
210 0.41
211 0.5
212 0.56
213 0.59
214 0.61
215 0.68
216 0.68
217 0.75
218 0.74
219 0.74
220 0.76
221 0.8
222 0.8
223 0.79