Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NGH7

Protein Details
Accession A0A1Y3NGH7    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
166-187DYYNTRNPKKTYKKDPKYLLASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR002067  Mit_carrier  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0055085  P:transmembrane transport  
Pfam View protein in Pfam  
PF00153  Mito_carr  
PROSITE View protein in PROSITE  
PS50920  SOLCAR  
Amino Acid Sequences MARDKKNNDINIKTLFSNIDRNNFGFITKSSLEDYLNTQYKLSKNIASSHASQLINLMSKKTDINAKINYNDFSKFIEKQEKELLSLYKELTASNKINNITTIENGITLNNLTEAFQNSENQNIKQTHLKGLIKTIGNKKEYITFNDLKEYLILSPQTNNIKNVYDYYNTRNPKKTYKKDPKYLLASAISGCVSRTMTAPLDRIRVLFQTHSRLGVKLTVKDGIKLIYENGGITSFWRGNGLNVLKIAPQTMLKFYLYEAYKPALNLKQTLKEGKKEGELDPRLKVLRDISIGAAGGLLSQVFIFPIEALKTRVMSETQRGKFAPPKTVTPSSSRKQNNLVMRIAKDMWREGGVRPFFRGLTPAVASALPYYLTDFTLYEQSKKLYLNIVNRNRTKGNKITKINPIYLLGAGMVSNACAVSLVYPFALVRTRLQAQGTIGHPMRYKNSLDVIRKTYTRESIRGFYNGIVPTLIKNVPSASISYVIYELCKKYMDLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.39
3 0.33
4 0.38
5 0.37
6 0.38
7 0.39
8 0.39
9 0.41
10 0.37
11 0.35
12 0.28
13 0.25
14 0.25
15 0.23
16 0.23
17 0.22
18 0.23
19 0.24
20 0.23
21 0.26
22 0.28
23 0.33
24 0.31
25 0.3
26 0.33
27 0.35
28 0.39
29 0.38
30 0.34
31 0.31
32 0.37
33 0.41
34 0.4
35 0.41
36 0.41
37 0.45
38 0.39
39 0.36
40 0.33
41 0.31
42 0.32
43 0.29
44 0.25
45 0.18
46 0.2
47 0.21
48 0.22
49 0.27
50 0.26
51 0.33
52 0.38
53 0.42
54 0.45
55 0.48
56 0.47
57 0.42
58 0.38
59 0.32
60 0.3
61 0.3
62 0.28
63 0.31
64 0.39
65 0.38
66 0.41
67 0.48
68 0.45
69 0.42
70 0.43
71 0.39
72 0.31
73 0.33
74 0.29
75 0.23
76 0.23
77 0.21
78 0.21
79 0.24
80 0.24
81 0.25
82 0.29
83 0.27
84 0.27
85 0.28
86 0.27
87 0.22
88 0.21
89 0.2
90 0.15
91 0.15
92 0.14
93 0.13
94 0.11
95 0.1
96 0.09
97 0.07
98 0.07
99 0.07
100 0.09
101 0.11
102 0.13
103 0.14
104 0.17
105 0.17
106 0.24
107 0.26
108 0.25
109 0.3
110 0.29
111 0.3
112 0.34
113 0.35
114 0.34
115 0.39
116 0.42
117 0.36
118 0.39
119 0.43
120 0.38
121 0.43
122 0.46
123 0.45
124 0.44
125 0.43
126 0.4
127 0.42
128 0.42
129 0.41
130 0.4
131 0.36
132 0.35
133 0.39
134 0.38
135 0.3
136 0.28
137 0.23
138 0.16
139 0.15
140 0.15
141 0.11
142 0.12
143 0.17
144 0.23
145 0.24
146 0.25
147 0.25
148 0.25
149 0.25
150 0.26
151 0.25
152 0.21
153 0.22
154 0.27
155 0.33
156 0.37
157 0.41
158 0.46
159 0.46
160 0.54
161 0.62
162 0.65
163 0.68
164 0.75
165 0.79
166 0.81
167 0.84
168 0.81
169 0.77
170 0.69
171 0.61
172 0.5
173 0.41
174 0.32
175 0.26
176 0.19
177 0.12
178 0.11
179 0.08
180 0.08
181 0.07
182 0.08
183 0.09
184 0.11
185 0.13
186 0.15
187 0.16
188 0.18
189 0.18
190 0.18
191 0.17
192 0.16
193 0.16
194 0.16
195 0.17
196 0.21
197 0.21
198 0.24
199 0.23
200 0.22
201 0.21
202 0.24
203 0.23
204 0.19
205 0.2
206 0.21
207 0.21
208 0.21
209 0.21
210 0.16
211 0.15
212 0.13
213 0.12
214 0.09
215 0.09
216 0.08
217 0.08
218 0.08
219 0.07
220 0.07
221 0.09
222 0.08
223 0.07
224 0.09
225 0.09
226 0.08
227 0.14
228 0.15
229 0.13
230 0.13
231 0.13
232 0.13
233 0.13
234 0.13
235 0.08
236 0.08
237 0.08
238 0.09
239 0.11
240 0.1
241 0.1
242 0.1
243 0.15
244 0.14
245 0.14
246 0.14
247 0.14
248 0.14
249 0.14
250 0.18
251 0.15
252 0.15
253 0.19
254 0.2
255 0.24
256 0.25
257 0.33
258 0.32
259 0.32
260 0.34
261 0.32
262 0.33
263 0.31
264 0.32
265 0.34
266 0.36
267 0.34
268 0.32
269 0.33
270 0.3
271 0.27
272 0.26
273 0.18
274 0.16
275 0.15
276 0.15
277 0.13
278 0.13
279 0.12
280 0.11
281 0.09
282 0.06
283 0.05
284 0.04
285 0.03
286 0.02
287 0.02
288 0.02
289 0.03
290 0.03
291 0.03
292 0.03
293 0.04
294 0.05
295 0.07
296 0.09
297 0.1
298 0.1
299 0.11
300 0.12
301 0.13
302 0.14
303 0.21
304 0.29
305 0.3
306 0.32
307 0.32
308 0.34
309 0.39
310 0.4
311 0.41
312 0.34
313 0.37
314 0.41
315 0.46
316 0.45
317 0.45
318 0.5
319 0.45
320 0.52
321 0.5
322 0.47
323 0.48
324 0.53
325 0.54
326 0.51
327 0.52
328 0.46
329 0.44
330 0.43
331 0.38
332 0.35
333 0.29
334 0.25
335 0.22
336 0.2
337 0.2
338 0.19
339 0.26
340 0.27
341 0.26
342 0.27
343 0.27
344 0.25
345 0.24
346 0.24
347 0.17
348 0.17
349 0.17
350 0.15
351 0.15
352 0.14
353 0.14
354 0.12
355 0.11
356 0.08
357 0.07
358 0.09
359 0.08
360 0.09
361 0.09
362 0.09
363 0.1
364 0.18
365 0.19
366 0.19
367 0.2
368 0.21
369 0.23
370 0.24
371 0.24
372 0.23
373 0.28
374 0.35
375 0.44
376 0.52
377 0.58
378 0.6
379 0.63
380 0.62
381 0.61
382 0.59
383 0.58
384 0.59
385 0.6
386 0.63
387 0.65
388 0.7
389 0.7
390 0.65
391 0.58
392 0.49
393 0.41
394 0.35
395 0.28
396 0.18
397 0.13
398 0.11
399 0.09
400 0.07
401 0.05
402 0.05
403 0.04
404 0.04
405 0.04
406 0.04
407 0.05
408 0.06
409 0.07
410 0.06
411 0.07
412 0.07
413 0.09
414 0.12
415 0.13
416 0.14
417 0.2
418 0.23
419 0.25
420 0.27
421 0.28
422 0.26
423 0.31
424 0.29
425 0.31
426 0.3
427 0.31
428 0.32
429 0.32
430 0.35
431 0.34
432 0.34
433 0.3
434 0.37
435 0.42
436 0.47
437 0.5
438 0.51
439 0.52
440 0.52
441 0.53
442 0.51
443 0.52
444 0.51
445 0.5
446 0.5
447 0.51
448 0.53
449 0.51
450 0.46
451 0.38
452 0.38
453 0.33
454 0.28
455 0.24
456 0.2
457 0.19
458 0.22
459 0.22
460 0.16
461 0.16
462 0.17
463 0.18
464 0.19
465 0.19
466 0.16
467 0.18
468 0.18
469 0.18
470 0.18
471 0.16
472 0.18
473 0.21
474 0.21
475 0.19
476 0.21