Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NCM4

Protein Details
Accession A0A1Y3NCM4    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-109LEKNIDKAKRDKKSLKSNNNIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13, nucl 12.5, cyto 10.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018608  Gti1/Pac2  
Pfam View protein in Pfam  
PF09729  Gti1_Pac2  
Amino Acid Sequences MIVLEENKLVETFYGFIENPKDGLILFQAVKDGLLPSVQRRLSVEQRIQIKSGSVFVFNETESNIKRWTDGRTWTPSRVQGDFLIYRELEKNIDKAKRDKKSLKSNNNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.13
4 0.16
5 0.16
6 0.15
7 0.15
8 0.14
9 0.1
10 0.11
11 0.1
12 0.1
13 0.1
14 0.1
15 0.1
16 0.1
17 0.1
18 0.09
19 0.08
20 0.06
21 0.07
22 0.08
23 0.09
24 0.16
25 0.17
26 0.17
27 0.19
28 0.24
29 0.29
30 0.35
31 0.36
32 0.34
33 0.39
34 0.4
35 0.38
36 0.33
37 0.27
38 0.21
39 0.21
40 0.16
41 0.11
42 0.1
43 0.11
44 0.11
45 0.1
46 0.1
47 0.08
48 0.09
49 0.1
50 0.11
51 0.12
52 0.11
53 0.13
54 0.14
55 0.18
56 0.21
57 0.25
58 0.29
59 0.35
60 0.39
61 0.41
62 0.42
63 0.43
64 0.43
65 0.39
66 0.36
67 0.29
68 0.31
69 0.3
70 0.27
71 0.25
72 0.21
73 0.21
74 0.21
75 0.21
76 0.19
77 0.18
78 0.23
79 0.27
80 0.33
81 0.36
82 0.44
83 0.53
84 0.59
85 0.67
86 0.71
87 0.73
88 0.79
89 0.86