Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MS55

Protein Details
Accession A0A1Y3MS55    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
19-43SVSARTIRKSLKIRRPKKHDEISLAHydrophilic
58-77DVKSKHRRFKLEKCRYLPKNBasic
NLS Segment(s)
PositionSequence
26-36RKSLKIRRPKK
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
Amino Acid Sequences MKFYNFLLCVVLLCTLQWSVSARTIRKSLKIRRPKKHDEISLALPEKINEDSELYIADVKSKHRRFKLEKCRYLPKNNVITCEYEKVLNKYKYRLDISILDKPECEINKETEIVSAKLWAMVKDTNVYKPNNEIKTQGKTKVLTDELYRSQQFQLYTNQDDCVINADFDTAKITRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.1
5 0.12
6 0.14
7 0.2
8 0.26
9 0.27
10 0.31
11 0.38
12 0.4
13 0.45
14 0.52
15 0.56
16 0.61
17 0.7
18 0.76
19 0.8
20 0.86
21 0.88
22 0.88
23 0.87
24 0.83
25 0.79
26 0.74
27 0.68
28 0.66
29 0.58
30 0.48
31 0.39
32 0.32
33 0.27
34 0.23
35 0.19
36 0.12
37 0.11
38 0.11
39 0.11
40 0.11
41 0.09
42 0.1
43 0.09
44 0.11
45 0.11
46 0.15
47 0.26
48 0.32
49 0.39
50 0.42
51 0.52
52 0.57
53 0.67
54 0.74
55 0.74
56 0.77
57 0.75
58 0.81
59 0.77
60 0.77
61 0.73
62 0.7
63 0.68
64 0.6
65 0.58
66 0.49
67 0.46
68 0.4
69 0.35
70 0.27
71 0.21
72 0.21
73 0.21
74 0.29
75 0.3
76 0.3
77 0.31
78 0.34
79 0.36
80 0.37
81 0.34
82 0.29
83 0.29
84 0.33
85 0.35
86 0.34
87 0.29
88 0.26
89 0.26
90 0.27
91 0.22
92 0.2
93 0.16
94 0.17
95 0.19
96 0.2
97 0.19
98 0.18
99 0.2
100 0.17
101 0.15
102 0.14
103 0.12
104 0.14
105 0.14
106 0.11
107 0.12
108 0.12
109 0.13
110 0.16
111 0.18
112 0.21
113 0.25
114 0.26
115 0.25
116 0.31
117 0.39
118 0.38
119 0.38
120 0.37
121 0.37
122 0.45
123 0.49
124 0.46
125 0.43
126 0.41
127 0.41
128 0.44
129 0.41
130 0.34
131 0.32
132 0.33
133 0.33
134 0.37
135 0.36
136 0.31
137 0.3
138 0.31
139 0.3
140 0.26
141 0.3
142 0.3
143 0.35
144 0.34
145 0.33
146 0.32
147 0.31
148 0.29
149 0.25
150 0.2
151 0.15
152 0.14
153 0.14
154 0.12
155 0.12
156 0.16