Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NRB7

Protein Details
Accession A0A1Y3NRB7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
23-43DPYNKCVRKMRNKWICTNRPKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, plas 6, E.R. 5, pero 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MKFNKIINLFTILSVLAIVNAEDPYNKCVRKMRNKWICTNRPKGAANKMYFLNDFKSTVNKICKDSVCISGYNNELPKELREKIQVNCRRNAITIFQNTIQESNLYFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.06
4 0.05
5 0.05
6 0.05
7 0.06
8 0.06
9 0.08
10 0.09
11 0.13
12 0.19
13 0.19
14 0.22
15 0.28
16 0.38
17 0.48
18 0.56
19 0.63
20 0.67
21 0.71
22 0.78
23 0.82
24 0.81
25 0.79
26 0.78
27 0.71
28 0.67
29 0.65
30 0.6
31 0.58
32 0.56
33 0.49
34 0.43
35 0.4
36 0.35
37 0.33
38 0.29
39 0.23
40 0.16
41 0.16
42 0.14
43 0.16
44 0.16
45 0.2
46 0.25
47 0.24
48 0.26
49 0.29
50 0.29
51 0.31
52 0.32
53 0.32
54 0.28
55 0.26
56 0.24
57 0.23
58 0.24
59 0.23
60 0.23
61 0.18
62 0.17
63 0.18
64 0.2
65 0.22
66 0.23
67 0.23
68 0.27
69 0.31
70 0.35
71 0.45
72 0.51
73 0.5
74 0.54
75 0.54
76 0.5
77 0.48
78 0.45
79 0.4
80 0.39
81 0.39
82 0.38
83 0.37
84 0.38
85 0.37
86 0.35
87 0.31
88 0.24