Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8ZVE7

Protein Details
Accession G8ZVE7    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-47GTPSGTPKGTPTKKNKVKSKPVAKKPAPSLTAHydrophilic
NLS Segment(s)
PositionSequence
9-12SKKS
16-43GTPSGTPKGTPTKKNKVKSKPVAKKPAP
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
IPR016095  Ribosomal_L1_3-a/b-sand  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
KEGG tdl:TDEL_0E03480  -  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
Amino Acid Sequences MAKKSRSSSKKSTPVGTPSGTPKGTPTKKNKVKSKPVAKKPAPSLTAVPRERIARSIQQLRKFEQKEEASESQSLLDDDDELNQLVQLIVVNNTSFTGANKQFKLKLATVKHSLYSAWNAASETSIKDFKVLLIVKDSDVNKISADDLIQEGQEKQVQVEIIGGKHLKTNYKEYERRRAFLSEFSLILADDNIITTLPKLLGGKAYNKLETTPIGIRAYANKQFSKKTLVNSFNKIYTSKLPVKLPRGTTVNVHLGNLAWFKDQQFVDNIELLLKEFIDNYSIRSVFVKCNNSPVLPLYYNQDVLDEISSKKQQEKREVPEDQLVDIDGVKVQLSTFDQALMEIANPDDVKDIFAKKINAAKRQRADDKEPETETVKKAKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.69
3 0.61
4 0.55
5 0.51
6 0.53
7 0.47
8 0.4
9 0.39
10 0.44
11 0.5
12 0.55
13 0.58
14 0.62
15 0.71
16 0.81
17 0.85
18 0.85
19 0.88
20 0.89
21 0.91
22 0.9
23 0.92
24 0.93
25 0.89
26 0.87
27 0.84
28 0.82
29 0.73
30 0.65
31 0.61
32 0.59
33 0.63
34 0.55
35 0.49
36 0.44
37 0.45
38 0.43
39 0.39
40 0.36
41 0.34
42 0.4
43 0.48
44 0.51
45 0.57
46 0.6
47 0.61
48 0.66
49 0.61
50 0.55
51 0.54
52 0.51
53 0.47
54 0.51
55 0.49
56 0.42
57 0.41
58 0.38
59 0.29
60 0.27
61 0.22
62 0.14
63 0.12
64 0.09
65 0.09
66 0.1
67 0.1
68 0.09
69 0.09
70 0.08
71 0.08
72 0.07
73 0.07
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.07
80 0.08
81 0.09
82 0.08
83 0.08
84 0.16
85 0.21
86 0.27
87 0.29
88 0.32
89 0.34
90 0.38
91 0.42
92 0.38
93 0.4
94 0.4
95 0.44
96 0.46
97 0.44
98 0.41
99 0.36
100 0.33
101 0.27
102 0.25
103 0.21
104 0.15
105 0.15
106 0.14
107 0.14
108 0.14
109 0.12
110 0.1
111 0.11
112 0.13
113 0.12
114 0.13
115 0.13
116 0.12
117 0.18
118 0.18
119 0.16
120 0.18
121 0.19
122 0.18
123 0.23
124 0.23
125 0.19
126 0.19
127 0.19
128 0.15
129 0.15
130 0.15
131 0.1
132 0.1
133 0.08
134 0.07
135 0.07
136 0.07
137 0.08
138 0.07
139 0.08
140 0.1
141 0.09
142 0.08
143 0.09
144 0.09
145 0.09
146 0.11
147 0.11
148 0.09
149 0.11
150 0.11
151 0.1
152 0.12
153 0.14
154 0.16
155 0.18
156 0.25
157 0.29
158 0.38
159 0.45
160 0.48
161 0.57
162 0.55
163 0.54
164 0.5
165 0.46
166 0.38
167 0.35
168 0.34
169 0.24
170 0.21
171 0.2
172 0.17
173 0.14
174 0.13
175 0.09
176 0.05
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.04
184 0.04
185 0.05
186 0.05
187 0.06
188 0.09
189 0.11
190 0.14
191 0.19
192 0.21
193 0.21
194 0.21
195 0.21
196 0.19
197 0.18
198 0.18
199 0.14
200 0.15
201 0.15
202 0.15
203 0.15
204 0.17
205 0.22
206 0.24
207 0.26
208 0.26
209 0.28
210 0.3
211 0.31
212 0.35
213 0.33
214 0.34
215 0.39
216 0.44
217 0.46
218 0.49
219 0.5
220 0.44
221 0.42
222 0.37
223 0.31
224 0.26
225 0.29
226 0.3
227 0.32
228 0.36
229 0.4
230 0.46
231 0.49
232 0.47
233 0.45
234 0.42
235 0.39
236 0.36
237 0.35
238 0.35
239 0.3
240 0.28
241 0.23
242 0.2
243 0.21
244 0.2
245 0.16
246 0.1
247 0.1
248 0.11
249 0.17
250 0.16
251 0.16
252 0.18
253 0.2
254 0.2
255 0.21
256 0.2
257 0.15
258 0.15
259 0.14
260 0.11
261 0.09
262 0.07
263 0.06
264 0.06
265 0.08
266 0.09
267 0.1
268 0.15
269 0.15
270 0.16
271 0.17
272 0.19
273 0.22
274 0.3
275 0.35
276 0.3
277 0.37
278 0.38
279 0.37
280 0.36
281 0.33
282 0.32
283 0.26
284 0.26
285 0.24
286 0.24
287 0.25
288 0.23
289 0.21
290 0.15
291 0.15
292 0.16
293 0.13
294 0.12
295 0.17
296 0.2
297 0.21
298 0.29
299 0.34
300 0.4
301 0.49
302 0.57
303 0.6
304 0.66
305 0.67
306 0.63
307 0.65
308 0.58
309 0.47
310 0.39
311 0.3
312 0.22
313 0.19
314 0.15
315 0.09
316 0.08
317 0.07
318 0.07
319 0.06
320 0.08
321 0.11
322 0.12
323 0.12
324 0.13
325 0.13
326 0.13
327 0.13
328 0.11
329 0.09
330 0.08
331 0.08
332 0.1
333 0.09
334 0.1
335 0.12
336 0.11
337 0.13
338 0.16
339 0.19
340 0.19
341 0.25
342 0.27
343 0.29
344 0.37
345 0.43
346 0.49
347 0.55
348 0.62
349 0.65
350 0.72
351 0.77
352 0.77
353 0.77
354 0.77
355 0.75
356 0.72
357 0.67
358 0.61
359 0.56
360 0.53
361 0.49