Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NT01

Protein Details
Accession A0A1Y3NT01   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-76KQLIQEFFRKNKKNNSNSNNSEYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR023780  Chromo_domain  
Pfam View protein in Pfam  
PF00385  Chromo  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
Amino Acid Sequences RRKNIHLNTDTNEKIPDKIIKMRTYKGKNRYLISCKGPKEYEDTWINEDQIIDKQLIQEFFRKNKKNNSNSNNSEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.31
4 0.27
5 0.33
6 0.38
7 0.41
8 0.45
9 0.49
10 0.55
11 0.59
12 0.63
13 0.64
14 0.66
15 0.64
16 0.64
17 0.65
18 0.61
19 0.58
20 0.56
21 0.54
22 0.47
23 0.46
24 0.43
25 0.36
26 0.36
27 0.31
28 0.31
29 0.27
30 0.28
31 0.27
32 0.28
33 0.27
34 0.22
35 0.21
36 0.16
37 0.15
38 0.14
39 0.1
40 0.1
41 0.12
42 0.14
43 0.16
44 0.16
45 0.21
46 0.26
47 0.34
48 0.44
49 0.5
50 0.54
51 0.63
52 0.72
53 0.75
54 0.8
55 0.81
56 0.81