Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZQH6

Protein Details
Accession G8ZQH6   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-35KSKGSFWDSRFRMRRRRHRLKKENNGIPETGBasic
NLS Segment(s)
PositionSequence
14-30RFRMRRRRHRLKKENNG
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
KEGG tdl:TDEL_0B07410  -  
Amino Acid Sequences MSQRKSKGSFWDSRFRMRRRRHRLKKENNGIPETGRRSIKQVLREYRDRRSAGSLHNVQLSTRNFKSFKTINFENSNLSHAENYSGSEIDPKVYYKQSSAPVGGAELTYREERSTESFVMRNLPRERSAVNSHFEPLKIHVTETKSAPECVASEKSYNETSRHLHEPSLLNFETNARTETSQESVRAYFHNNTGNYNQHFAPRSDTGTVSVESVISSTPSDHQVVPEKNGNGVMKKIESSILSFFGFGSTKESSMRQTNKSQSSTGPTSDRIMSFFSYQSAKGTNKWDFPTNTATEEIDYSIYGSHAKYYM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.73
3 0.75
4 0.77
5 0.82
6 0.83
7 0.9
8 0.91
9 0.93
10 0.95
11 0.96
12 0.97
13 0.96
14 0.94
15 0.9
16 0.83
17 0.73
18 0.66
19 0.63
20 0.57
21 0.53
22 0.47
23 0.4
24 0.41
25 0.48
26 0.48
27 0.49
28 0.53
29 0.57
30 0.61
31 0.7
32 0.7
33 0.7
34 0.74
35 0.66
36 0.59
37 0.55
38 0.52
39 0.48
40 0.52
41 0.48
42 0.42
43 0.45
44 0.42
45 0.37
46 0.39
47 0.37
48 0.35
49 0.32
50 0.36
51 0.33
52 0.33
53 0.41
54 0.39
55 0.4
56 0.41
57 0.42
58 0.43
59 0.47
60 0.47
61 0.43
62 0.39
63 0.35
64 0.28
65 0.25
66 0.19
67 0.15
68 0.16
69 0.12
70 0.13
71 0.12
72 0.11
73 0.1
74 0.13
75 0.13
76 0.12
77 0.13
78 0.13
79 0.15
80 0.18
81 0.19
82 0.17
83 0.22
84 0.25
85 0.27
86 0.26
87 0.23
88 0.21
89 0.2
90 0.19
91 0.13
92 0.09
93 0.07
94 0.08
95 0.09
96 0.09
97 0.09
98 0.09
99 0.1
100 0.14
101 0.17
102 0.16
103 0.18
104 0.18
105 0.19
106 0.25
107 0.24
108 0.28
109 0.27
110 0.29
111 0.28
112 0.29
113 0.29
114 0.28
115 0.33
116 0.29
117 0.29
118 0.27
119 0.27
120 0.26
121 0.25
122 0.21
123 0.17
124 0.19
125 0.16
126 0.16
127 0.18
128 0.2
129 0.22
130 0.22
131 0.24
132 0.2
133 0.2
134 0.19
135 0.16
136 0.14
137 0.15
138 0.16
139 0.13
140 0.13
141 0.13
142 0.16
143 0.18
144 0.19
145 0.17
146 0.17
147 0.18
148 0.21
149 0.24
150 0.22
151 0.2
152 0.22
153 0.24
154 0.23
155 0.27
156 0.23
157 0.19
158 0.19
159 0.2
160 0.18
161 0.15
162 0.15
163 0.1
164 0.11
165 0.12
166 0.13
167 0.15
168 0.15
169 0.15
170 0.15
171 0.15
172 0.15
173 0.15
174 0.17
175 0.16
176 0.18
177 0.23
178 0.22
179 0.24
180 0.26
181 0.31
182 0.28
183 0.29
184 0.27
185 0.25
186 0.27
187 0.24
188 0.26
189 0.22
190 0.24
191 0.23
192 0.22
193 0.2
194 0.2
195 0.2
196 0.16
197 0.14
198 0.11
199 0.1
200 0.09
201 0.07
202 0.06
203 0.06
204 0.06
205 0.07
206 0.1
207 0.12
208 0.12
209 0.15
210 0.23
211 0.24
212 0.27
213 0.31
214 0.29
215 0.28
216 0.32
217 0.31
218 0.25
219 0.24
220 0.23
221 0.18
222 0.19
223 0.18
224 0.16
225 0.15
226 0.16
227 0.16
228 0.16
229 0.15
230 0.15
231 0.14
232 0.14
233 0.14
234 0.11
235 0.14
236 0.13
237 0.14
238 0.16
239 0.17
240 0.2
241 0.28
242 0.34
243 0.35
244 0.42
245 0.5
246 0.55
247 0.57
248 0.54
249 0.49
250 0.5
251 0.49
252 0.45
253 0.39
254 0.34
255 0.34
256 0.35
257 0.33
258 0.26
259 0.25
260 0.23
261 0.22
262 0.21
263 0.2
264 0.19
265 0.19
266 0.2
267 0.23
268 0.23
269 0.25
270 0.32
271 0.35
272 0.39
273 0.43
274 0.48
275 0.45
276 0.47
277 0.5
278 0.44
279 0.41
280 0.37
281 0.34
282 0.27
283 0.26
284 0.23
285 0.17
286 0.14
287 0.12
288 0.11
289 0.11
290 0.11
291 0.1