Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3N3X2

Protein Details
Accession A0A1Y3N3X2    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
131-152VPNSSNKKVQKSCKLHNNESDNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002180  LS/RS  
IPR036467  LS/RS_sf  
Gene Ontology GO:0009349  C:riboflavin synthase complex  
GO:0000906  F:6,7-dimethyl-8-ribityllumazine synthase activity  
GO:0009231  P:riboflavin biosynthetic process  
Pfam View protein in Pfam  
PF00885  DMRL_synthase  
Amino Acid Sequences NIYQYSVNRPYELSYTAFNLINVAKNDGKLFDAVICIGLLLNNLLDEIDNNKVSQTYWIDSITQTVMKVSIKTNTPIIHGIIHDYEGNIKNNNILNNHSNGIKSIDKCNGLLPSLTTLNNNNNFSNIFKTVPNSSNKKVQKSCKLHNNESDNNESYNIETEKKTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.24
4 0.24
5 0.21
6 0.2
7 0.19
8 0.22
9 0.21
10 0.23
11 0.21
12 0.22
13 0.23
14 0.21
15 0.21
16 0.16
17 0.15
18 0.11
19 0.11
20 0.09
21 0.09
22 0.08
23 0.07
24 0.06
25 0.06
26 0.05
27 0.05
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.06
35 0.09
36 0.1
37 0.1
38 0.1
39 0.11
40 0.11
41 0.14
42 0.15
43 0.13
44 0.14
45 0.15
46 0.15
47 0.15
48 0.16
49 0.13
50 0.11
51 0.1
52 0.08
53 0.09
54 0.09
55 0.1
56 0.1
57 0.12
58 0.13
59 0.14
60 0.17
61 0.17
62 0.18
63 0.18
64 0.17
65 0.15
66 0.13
67 0.13
68 0.1
69 0.11
70 0.09
71 0.08
72 0.1
73 0.12
74 0.13
75 0.12
76 0.12
77 0.14
78 0.16
79 0.19
80 0.16
81 0.17
82 0.18
83 0.2
84 0.21
85 0.19
86 0.17
87 0.15
88 0.18
89 0.19
90 0.18
91 0.2
92 0.23
93 0.23
94 0.24
95 0.25
96 0.22
97 0.19
98 0.18
99 0.15
100 0.14
101 0.15
102 0.15
103 0.14
104 0.16
105 0.23
106 0.28
107 0.3
108 0.27
109 0.26
110 0.27
111 0.27
112 0.28
113 0.23
114 0.19
115 0.17
116 0.2
117 0.24
118 0.29
119 0.35
120 0.38
121 0.39
122 0.48
123 0.53
124 0.59
125 0.62
126 0.66
127 0.7
128 0.72
129 0.78
130 0.78
131 0.81
132 0.79
133 0.81
134 0.79
135 0.76
136 0.72
137 0.69
138 0.61
139 0.53
140 0.47
141 0.38
142 0.3
143 0.29
144 0.26
145 0.22