Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N3E0

Protein Details
Accession A0A1Y3N3E0    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
85-113IKSIHKQYITFKKRRRRMDIKKRLKVIETHydrophilic
NLS Segment(s)
PositionSequence
96-108KKRRRRMDIKKRL
Subcellular Location(s) nucl 15.5, cyto_nucl 9.333, mito 6.5, cyto_mito 4.833, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLLKTLQSNKTLNSYNYFYLTKTPLEINDDIKPDKRESKTFIKPNTEKYLIVPTDLKYTELLEELIRTSLRPTLMILIIIILLIIKSIHKQYITFKKRRRRMDIKKRLKVIETQTVPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.36
4 0.35
5 0.29
6 0.29
7 0.29
8 0.24
9 0.22
10 0.21
11 0.19
12 0.24
13 0.25
14 0.24
15 0.25
16 0.28
17 0.28
18 0.31
19 0.32
20 0.3
21 0.36
22 0.37
23 0.37
24 0.39
25 0.47
26 0.52
27 0.57
28 0.59
29 0.61
30 0.59
31 0.62
32 0.63
33 0.56
34 0.47
35 0.41
36 0.43
37 0.33
38 0.32
39 0.27
40 0.2
41 0.22
42 0.22
43 0.2
44 0.13
45 0.13
46 0.12
47 0.11
48 0.11
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.06
55 0.07
56 0.08
57 0.09
58 0.09
59 0.09
60 0.1
61 0.1
62 0.1
63 0.09
64 0.07
65 0.07
66 0.06
67 0.05
68 0.03
69 0.02
70 0.02
71 0.03
72 0.03
73 0.05
74 0.07
75 0.1
76 0.1
77 0.12
78 0.21
79 0.33
80 0.42
81 0.5
82 0.57
83 0.66
84 0.74
85 0.83
86 0.84
87 0.84
88 0.86
89 0.88
90 0.91
91 0.92
92 0.92
93 0.9
94 0.84
95 0.76
96 0.72
97 0.69
98 0.68