Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9A0A2

Protein Details
Accession G9A0A2   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
146-171IGPQLATKRPRPPVKQKPKHLQTGWSHydrophilic
NLS Segment(s)
PositionSequence
155-160PRPPVK
Subcellular Location(s) cyto 13, nucl 12.5, mito_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001715  CH_dom  
IPR036872  CH_dom_sf  
IPR003096  SM22_calponin  
Gene Ontology GO:0016043  P:cellular component organization  
KEGG tdl:TDEL_0H04370  -  
Pfam View protein in Pfam  
PF00307  CH  
PROSITE View protein in PROSITE  
PS50021  CH  
Amino Acid Sequences MSYDKKADVTSLDEDLKLLRDTKFSQDAIDDIKSWIFVSVLNEEQPRESLIESLKSGVTLCKVANKLKAADETSGFIKWKESKMPFVQMEQISQFLTFARSYGVPEDELFQTVDLFEEKDPAIVYQTLKSVSRYANKKHPDLFPVIGPQLATKRPRPPVKQKPKHLQTGWSTTEYGYMGGASQKSEGIVFGQRRNIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.22
4 0.18
5 0.18
6 0.15
7 0.18
8 0.21
9 0.27
10 0.32
11 0.29
12 0.29
13 0.27
14 0.28
15 0.28
16 0.26
17 0.21
18 0.16
19 0.16
20 0.15
21 0.14
22 0.13
23 0.09
24 0.09
25 0.11
26 0.13
27 0.15
28 0.17
29 0.18
30 0.18
31 0.18
32 0.18
33 0.16
34 0.13
35 0.12
36 0.12
37 0.13
38 0.15
39 0.14
40 0.15
41 0.14
42 0.13
43 0.13
44 0.12
45 0.11
46 0.11
47 0.1
48 0.15
49 0.18
50 0.21
51 0.25
52 0.27
53 0.27
54 0.28
55 0.31
56 0.27
57 0.25
58 0.23
59 0.2
60 0.19
61 0.18
62 0.16
63 0.13
64 0.15
65 0.16
66 0.17
67 0.23
68 0.23
69 0.28
70 0.3
71 0.37
72 0.34
73 0.32
74 0.36
75 0.29
76 0.28
77 0.23
78 0.21
79 0.15
80 0.14
81 0.12
82 0.07
83 0.08
84 0.07
85 0.06
86 0.07
87 0.06
88 0.07
89 0.08
90 0.09
91 0.08
92 0.08
93 0.1
94 0.1
95 0.1
96 0.1
97 0.08
98 0.07
99 0.07
100 0.07
101 0.05
102 0.06
103 0.05
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.09
110 0.09
111 0.1
112 0.1
113 0.11
114 0.12
115 0.13
116 0.14
117 0.16
118 0.19
119 0.26
120 0.31
121 0.35
122 0.43
123 0.47
124 0.5
125 0.52
126 0.51
127 0.47
128 0.46
129 0.42
130 0.35
131 0.34
132 0.3
133 0.25
134 0.22
135 0.2
136 0.18
137 0.22
138 0.25
139 0.26
140 0.34
141 0.43
142 0.52
143 0.59
144 0.67
145 0.73
146 0.8
147 0.85
148 0.88
149 0.9
150 0.88
151 0.89
152 0.81
153 0.78
154 0.73
155 0.71
156 0.65
157 0.56
158 0.49
159 0.39
160 0.38
161 0.3
162 0.23
163 0.15
164 0.11
165 0.09
166 0.12
167 0.12
168 0.11
169 0.11
170 0.11
171 0.12
172 0.12
173 0.11
174 0.11
175 0.18
176 0.22
177 0.26