Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3MP85

Protein Details
Accession A0A1Y3MP85    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
28-51EETKNIKSSKKGNRSTKGKTEKIEHydrophilic
NLS Segment(s)
PositionSequence
307-312GRKRKR
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR001357  BRCT_dom  
IPR036420  BRCT_dom_sf  
Pfam View protein in Pfam  
PF16770  RTT107_BRCT_5  
PROSITE View protein in PROSITE  
PS50172  BRCT  
CDD cd17744  BRCT_MDC1_rpt1  
cd18432  BRCT_PAXIP1_rpt6_like  
Amino Acid Sequences MREKKSIKNKINENIEIEEDDKTINKEEETKNIKSSKKGNRSTKGKTEKIEDDITTNKQHDTVEVNRKRKNNEINESDDNLKSAKKSKINIGIDEEENVDIPRIIFTGIDDHYVNIVKDLGGIVEESWENCTHLVTDKIRRTVKFLCVLATGKKIVSLNWVKASKKAGKFLDPNKYILKDPASEKKWKFTMKSSLKTAHDNRDNPLFKGLTFYMTPNTKPPFDEMETIINAAGGTLIKDLPEEVDNDIVILSCPDDSSVCKSLVKQGYDNIHSNEFILSGILKQSVDYKSYKMKFENTTKSHSTSGGRKRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.57
3 0.49
4 0.41
5 0.32
6 0.24
7 0.2
8 0.17
9 0.16
10 0.18
11 0.17
12 0.17
13 0.25
14 0.27
15 0.36
16 0.41
17 0.42
18 0.45
19 0.51
20 0.54
21 0.52
22 0.59
23 0.6
24 0.64
25 0.71
26 0.75
27 0.78
28 0.83
29 0.85
30 0.86
31 0.85
32 0.8
33 0.74
34 0.71
35 0.66
36 0.62
37 0.58
38 0.48
39 0.42
40 0.4
41 0.4
42 0.37
43 0.33
44 0.28
45 0.25
46 0.24
47 0.23
48 0.24
49 0.29
50 0.36
51 0.44
52 0.51
53 0.55
54 0.6
55 0.63
56 0.65
57 0.67
58 0.66
59 0.66
60 0.64
61 0.65
62 0.65
63 0.64
64 0.58
65 0.48
66 0.39
67 0.3
68 0.26
69 0.21
70 0.23
71 0.27
72 0.29
73 0.32
74 0.39
75 0.48
76 0.51
77 0.51
78 0.5
79 0.46
80 0.41
81 0.39
82 0.32
83 0.22
84 0.19
85 0.16
86 0.1
87 0.07
88 0.07
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.09
95 0.09
96 0.11
97 0.11
98 0.11
99 0.12
100 0.13
101 0.13
102 0.09
103 0.09
104 0.07
105 0.07
106 0.07
107 0.05
108 0.04
109 0.04
110 0.04
111 0.05
112 0.05
113 0.05
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.08
121 0.12
122 0.14
123 0.22
124 0.25
125 0.32
126 0.36
127 0.36
128 0.39
129 0.39
130 0.41
131 0.38
132 0.35
133 0.29
134 0.27
135 0.28
136 0.25
137 0.23
138 0.18
139 0.13
140 0.14
141 0.13
142 0.11
143 0.17
144 0.18
145 0.19
146 0.24
147 0.27
148 0.26
149 0.28
150 0.34
151 0.34
152 0.34
153 0.38
154 0.34
155 0.37
156 0.43
157 0.47
158 0.51
159 0.46
160 0.46
161 0.42
162 0.42
163 0.36
164 0.33
165 0.28
166 0.21
167 0.24
168 0.3
169 0.31
170 0.37
171 0.37
172 0.41
173 0.44
174 0.45
175 0.44
176 0.41
177 0.48
178 0.49
179 0.54
180 0.53
181 0.54
182 0.52
183 0.58
184 0.56
185 0.55
186 0.54
187 0.5
188 0.48
189 0.51
190 0.5
191 0.43
192 0.42
193 0.33
194 0.25
195 0.28
196 0.26
197 0.19
198 0.18
199 0.18
200 0.19
201 0.21
202 0.22
203 0.23
204 0.26
205 0.25
206 0.25
207 0.27
208 0.28
209 0.28
210 0.3
211 0.26
212 0.26
213 0.26
214 0.25
215 0.22
216 0.16
217 0.13
218 0.1
219 0.08
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.06
226 0.06
227 0.07
228 0.08
229 0.09
230 0.09
231 0.1
232 0.1
233 0.1
234 0.1
235 0.08
236 0.07
237 0.06
238 0.05
239 0.05
240 0.05
241 0.05
242 0.06
243 0.08
244 0.14
245 0.17
246 0.18
247 0.19
248 0.2
249 0.29
250 0.35
251 0.36
252 0.32
253 0.36
254 0.42
255 0.46
256 0.49
257 0.43
258 0.39
259 0.35
260 0.34
261 0.28
262 0.21
263 0.16
264 0.12
265 0.09
266 0.08
267 0.09
268 0.1
269 0.09
270 0.1
271 0.15
272 0.17
273 0.2
274 0.21
275 0.24
276 0.33
277 0.38
278 0.43
279 0.41
280 0.46
281 0.52
282 0.6
283 0.66
284 0.61
285 0.64
286 0.63
287 0.63
288 0.58
289 0.53
290 0.49
291 0.49
292 0.55