Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NAP6

Protein Details
Accession A0A1Y3NAP6    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-82VPEVPKQKTKKEVKKPKLRRSIGSBasic
93-124REEAVEKKRKVKKQQKKEKTRKAKKEEQELDEBasic
NLS Segment(s)
PositionSequence
64-117KQKTKKEVKKPKLRRSIGSISLDKKIKEDREEAVEKKRKVKKQQKKEKTRKAKK
Subcellular Location(s) nucl 21, cyto 6
Family & Domain DBs
Amino Acid Sequences MDENNKKGLKENITMIEDPEELLDEQLNKIQSKEKVIVKSNIPSVVITIDENGATTKEVPEVPKQKTKKEVKKPKLRRSIGSISLDKKIKEDREEAVEKKRKVKKQQKKEKTRKAKKEEQELDEETELSFNTSFILDAPSVLFDEETKKSILPEEKPKVPKRISSCPTECPFTDDFAKELMDDYNKKFGEMEKEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.42
3 0.37
4 0.31
5 0.26
6 0.21
7 0.16
8 0.12
9 0.12
10 0.12
11 0.1
12 0.11
13 0.14
14 0.17
15 0.15
16 0.16
17 0.22
18 0.24
19 0.28
20 0.34
21 0.37
22 0.41
23 0.46
24 0.5
25 0.47
26 0.49
27 0.47
28 0.42
29 0.37
30 0.3
31 0.25
32 0.21
33 0.17
34 0.13
35 0.1
36 0.09
37 0.08
38 0.08
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.08
45 0.1
46 0.12
47 0.2
48 0.27
49 0.31
50 0.39
51 0.42
52 0.45
53 0.54
54 0.62
55 0.64
56 0.69
57 0.75
58 0.77
59 0.85
60 0.91
61 0.91
62 0.92
63 0.85
64 0.77
65 0.74
66 0.7
67 0.66
68 0.6
69 0.53
70 0.45
71 0.46
72 0.45
73 0.37
74 0.32
75 0.3
76 0.28
77 0.27
78 0.27
79 0.23
80 0.28
81 0.32
82 0.32
83 0.36
84 0.4
85 0.39
86 0.46
87 0.51
88 0.52
89 0.59
90 0.69
91 0.7
92 0.74
93 0.84
94 0.86
95 0.9
96 0.94
97 0.94
98 0.94
99 0.94
100 0.93
101 0.91
102 0.9
103 0.85
104 0.85
105 0.81
106 0.73
107 0.69
108 0.6
109 0.54
110 0.44
111 0.37
112 0.26
113 0.19
114 0.15
115 0.11
116 0.08
117 0.05
118 0.06
119 0.06
120 0.06
121 0.06
122 0.08
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.08
129 0.07
130 0.06
131 0.1
132 0.11
133 0.13
134 0.13
135 0.13
136 0.14
137 0.19
138 0.25
139 0.27
140 0.36
141 0.41
142 0.49
143 0.58
144 0.64
145 0.67
146 0.65
147 0.66
148 0.63
149 0.67
150 0.63
151 0.63
152 0.62
153 0.61
154 0.61
155 0.58
156 0.51
157 0.46
158 0.43
159 0.37
160 0.38
161 0.3
162 0.27
163 0.24
164 0.24
165 0.19
166 0.19
167 0.18
168 0.2
169 0.22
170 0.25
171 0.33
172 0.32
173 0.33
174 0.33
175 0.33