Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N2I2

Protein Details
Accession A0A1Y3N2I2    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
44-74SSGYCARHCNNGKRDRKSNKRDKGKAPAGTDHydrophilic
NLS Segment(s)
PositionSequence
56-68KRDRKSNKRDKGK
Subcellular Location(s) nucl 10, mito 8, cyto 8, cyto_mito 8
Family & Domain DBs
Amino Acid Sequences MCGIKLQKIKKPFGVSDLGYGIFKVKKETENPTNYHNNKKISFSSGYCARHCNNGKRDRKSNKRDKGKAPAGTDSDDSEISKPKNDDDKLCAEVYPNFQYIKSKNIEKDKIKNKIWEIIELKNKELPPYEKIVRLTMREIPFEKTASNKIMRNKFKEILIARKKNNEKTKKENILPPENEMKKSLYDIISIALSISEPYSLDSVNVTILTNKLREKYSIPLHLRDIIENTSVLKIENIILELQKDNENNNYKIDMTVYETYPITVGEAFFMHLMRGISSSNIAGLFKLDKGIDLKFLKNSFVKLLDINIELKSKIYKDENGEVKLHRNDNANVNIAFEKITDKEWEIKKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.51
3 0.47
4 0.42
5 0.36
6 0.28
7 0.26
8 0.25
9 0.2
10 0.2
11 0.21
12 0.23
13 0.28
14 0.34
15 0.43
16 0.49
17 0.54
18 0.56
19 0.58
20 0.64
21 0.63
22 0.68
23 0.65
24 0.62
25 0.57
26 0.6
27 0.56
28 0.52
29 0.51
30 0.43
31 0.43
32 0.45
33 0.46
34 0.43
35 0.45
36 0.4
37 0.46
38 0.52
39 0.55
40 0.56
41 0.62
42 0.7
43 0.73
44 0.83
45 0.84
46 0.87
47 0.88
48 0.89
49 0.89
50 0.9
51 0.91
52 0.89
53 0.89
54 0.87
55 0.82
56 0.75
57 0.71
58 0.63
59 0.56
60 0.49
61 0.39
62 0.32
63 0.26
64 0.23
65 0.18
66 0.21
67 0.19
68 0.23
69 0.22
70 0.25
71 0.34
72 0.36
73 0.38
74 0.37
75 0.41
76 0.39
77 0.39
78 0.34
79 0.27
80 0.27
81 0.27
82 0.26
83 0.23
84 0.2
85 0.2
86 0.26
87 0.25
88 0.29
89 0.28
90 0.31
91 0.35
92 0.44
93 0.52
94 0.53
95 0.62
96 0.64
97 0.69
98 0.68
99 0.68
100 0.61
101 0.6
102 0.55
103 0.53
104 0.47
105 0.44
106 0.48
107 0.43
108 0.42
109 0.38
110 0.37
111 0.31
112 0.32
113 0.28
114 0.23
115 0.29
116 0.3
117 0.29
118 0.3
119 0.33
120 0.32
121 0.31
122 0.3
123 0.31
124 0.3
125 0.29
126 0.3
127 0.28
128 0.27
129 0.26
130 0.24
131 0.19
132 0.21
133 0.22
134 0.24
135 0.25
136 0.31
137 0.4
138 0.46
139 0.49
140 0.51
141 0.49
142 0.46
143 0.48
144 0.43
145 0.45
146 0.48
147 0.5
148 0.46
149 0.53
150 0.58
151 0.6
152 0.67
153 0.66
154 0.63
155 0.64
156 0.72
157 0.71
158 0.69
159 0.65
160 0.62
161 0.61
162 0.55
163 0.49
164 0.48
165 0.42
166 0.39
167 0.36
168 0.31
169 0.22
170 0.23
171 0.22
172 0.14
173 0.13
174 0.12
175 0.11
176 0.1
177 0.09
178 0.08
179 0.05
180 0.05
181 0.04
182 0.04
183 0.03
184 0.03
185 0.04
186 0.05
187 0.05
188 0.05
189 0.05
190 0.06
191 0.06
192 0.06
193 0.05
194 0.05
195 0.07
196 0.08
197 0.1
198 0.12
199 0.14
200 0.14
201 0.16
202 0.18
203 0.24
204 0.28
205 0.35
206 0.37
207 0.37
208 0.38
209 0.42
210 0.4
211 0.34
212 0.3
213 0.22
214 0.2
215 0.17
216 0.16
217 0.12
218 0.11
219 0.11
220 0.08
221 0.07
222 0.07
223 0.08
224 0.08
225 0.08
226 0.08
227 0.09
228 0.1
229 0.11
230 0.13
231 0.13
232 0.14
233 0.21
234 0.26
235 0.26
236 0.27
237 0.27
238 0.24
239 0.24
240 0.23
241 0.17
242 0.16
243 0.18
244 0.17
245 0.17
246 0.17
247 0.17
248 0.16
249 0.15
250 0.1
251 0.08
252 0.08
253 0.07
254 0.07
255 0.07
256 0.08
257 0.08
258 0.07
259 0.08
260 0.09
261 0.08
262 0.09
263 0.09
264 0.09
265 0.1
266 0.1
267 0.09
268 0.1
269 0.09
270 0.08
271 0.1
272 0.1
273 0.09
274 0.12
275 0.11
276 0.12
277 0.14
278 0.15
279 0.21
280 0.22
281 0.25
282 0.28
283 0.29
284 0.32
285 0.32
286 0.33
287 0.29
288 0.29
289 0.28
290 0.23
291 0.24
292 0.22
293 0.22
294 0.22
295 0.2
296 0.2
297 0.18
298 0.18
299 0.2
300 0.18
301 0.22
302 0.25
303 0.29
304 0.33
305 0.42
306 0.48
307 0.48
308 0.5
309 0.47
310 0.5
311 0.52
312 0.48
313 0.43
314 0.42
315 0.43
316 0.47
317 0.5
318 0.46
319 0.39
320 0.39
321 0.36
322 0.31
323 0.27
324 0.19
325 0.18
326 0.14
327 0.17
328 0.17
329 0.2
330 0.28
331 0.37