Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NE19

Protein Details
Accession A0A1Y3NE19    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
89-113FFLIKIFVIKKKKKKIFNNIKTFLYHydrophilic
NLS Segment(s)
PositionSequence
98-103KKKKKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR033896  MADS_MEF2-like  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0005634  C:nucleus  
GO:0046983  F:protein dimerization activity  
GO:0000977  F:RNA polymerase II transcription regulatory region sequence-specific DNA binding  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS00350  MADS_BOX_1  
PS50066  MADS_BOX_2  
CDD cd00265  MADS_MEF2_like  
Amino Acid Sequences MGRKKIAIKKITDERNRQVTFSKRKFGLMKKAYELSVLCGCEVGLIMFTANNKLFQYASSDIDRILLRYTEYNEPHESRTNDDIMKVSFFLIKIFVIKKKKKKIFNNIKTFLYIYIYIHIYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.75
3 0.71
4 0.64
5 0.61
6 0.61
7 0.63
8 0.61
9 0.61
10 0.51
11 0.57
12 0.62
13 0.62
14 0.63
15 0.59
16 0.57
17 0.53
18 0.54
19 0.48
20 0.44
21 0.36
22 0.29
23 0.26
24 0.22
25 0.17
26 0.15
27 0.14
28 0.12
29 0.12
30 0.07
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.07
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.09
43 0.14
44 0.13
45 0.16
46 0.16
47 0.16
48 0.15
49 0.17
50 0.17
51 0.12
52 0.11
53 0.08
54 0.08
55 0.09
56 0.12
57 0.16
58 0.18
59 0.21
60 0.24
61 0.25
62 0.27
63 0.32
64 0.3
65 0.29
66 0.3
67 0.29
68 0.26
69 0.25
70 0.24
71 0.19
72 0.19
73 0.14
74 0.12
75 0.11
76 0.11
77 0.1
78 0.1
79 0.09
80 0.12
81 0.15
82 0.22
83 0.31
84 0.4
85 0.5
86 0.6
87 0.68
88 0.75
89 0.82
90 0.86
91 0.88
92 0.89
93 0.9
94 0.85
95 0.78
96 0.71
97 0.61
98 0.51
99 0.43
100 0.34
101 0.24
102 0.22