Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NZ20

Protein Details
Accession A0A1Y3NZ20    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
59-93NWEKCKKCLIERYPRIKRLNKIRKKQNKVNAYNNEHydrophilic
124-162RDRSHNSRRKNVNNNNSNNKGRNSKSTRRRENNYKEEAYHydrophilic
NLS Segment(s)
PositionSequence
74-83IKRLNKIRKK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MKFDKDGDIDLYLSNMENIFENLKDLGDEPSEESKYNYLYNSLPKSVIHETGLVVYQDNWEKCKKCLIERYPRIKRLNKIRKKQNKVNAYNNEVRPRVNKHNKHNQYNLNIRCFNCGKFGHVFRDRSHNSRRKNVNNNNSNNKGRNSKSTRRRENNYKEEAYNAEVSEEELRYNQVFDNILSEDYNDEDNNVEFNNTQIQENSGNFRKRLKNLHNNH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.09
3 0.08
4 0.08
5 0.1
6 0.11
7 0.1
8 0.12
9 0.11
10 0.11
11 0.11
12 0.11
13 0.12
14 0.11
15 0.12
16 0.14
17 0.19
18 0.21
19 0.21
20 0.21
21 0.21
22 0.22
23 0.22
24 0.19
25 0.17
26 0.18
27 0.25
28 0.28
29 0.28
30 0.27
31 0.25
32 0.3
33 0.3
34 0.3
35 0.24
36 0.2
37 0.19
38 0.19
39 0.21
40 0.15
41 0.12
42 0.1
43 0.12
44 0.17
45 0.17
46 0.19
47 0.23
48 0.25
49 0.25
50 0.33
51 0.33
52 0.35
53 0.44
54 0.51
55 0.56
56 0.64
57 0.74
58 0.76
59 0.81
60 0.82
61 0.78
62 0.77
63 0.77
64 0.78
65 0.77
66 0.78
67 0.81
68 0.84
69 0.86
70 0.88
71 0.86
72 0.85
73 0.83
74 0.83
75 0.78
76 0.74
77 0.72
78 0.66
79 0.62
80 0.52
81 0.46
82 0.4
83 0.4
84 0.44
85 0.47
86 0.51
87 0.54
88 0.65
89 0.72
90 0.75
91 0.75
92 0.7
93 0.67
94 0.68
95 0.63
96 0.57
97 0.52
98 0.46
99 0.44
100 0.39
101 0.33
102 0.29
103 0.26
104 0.24
105 0.24
106 0.27
107 0.29
108 0.34
109 0.36
110 0.31
111 0.41
112 0.4
113 0.42
114 0.5
115 0.5
116 0.49
117 0.56
118 0.64
119 0.64
120 0.72
121 0.76
122 0.76
123 0.78
124 0.81
125 0.8
126 0.78
127 0.73
128 0.66
129 0.6
130 0.57
131 0.5
132 0.52
133 0.52
134 0.55
135 0.61
136 0.68
137 0.75
138 0.77
139 0.84
140 0.84
141 0.86
142 0.85
143 0.83
144 0.76
145 0.65
146 0.59
147 0.52
148 0.44
149 0.35
150 0.26
151 0.19
152 0.15
153 0.16
154 0.16
155 0.14
156 0.11
157 0.1
158 0.12
159 0.12
160 0.13
161 0.12
162 0.12
163 0.12
164 0.12
165 0.14
166 0.13
167 0.14
168 0.13
169 0.13
170 0.11
171 0.12
172 0.14
173 0.11
174 0.1
175 0.1
176 0.11
177 0.11
178 0.11
179 0.11
180 0.09
181 0.1
182 0.17
183 0.16
184 0.17
185 0.17
186 0.2
187 0.23
188 0.25
189 0.31
190 0.33
191 0.37
192 0.38
193 0.46
194 0.51
195 0.54
196 0.63
197 0.66