Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MSD1

Protein Details
Accession A0A1Y3MSD1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
31-59LSDNDHKNKNKKENKEEKKNNKKYSRIECHydrophilic
NLS Segment(s)
PositionSequence
38-53NKNKKENKEEKKNNKK
Subcellular Location(s) nucl 16.5, cyto_nucl 13.833, cyto 8, cyto_pero 4.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR002068  A-crystallin/Hsp20_dom  
IPR008978  HSP20-like_chaperone  
IPR031107  Small_HSP  
Pfam View protein in Pfam  
PF00011  HSP20  
PROSITE View protein in PROSITE  
PS01031  SHSP  
CDD cd06464  ACD_sHsps-like  
Amino Acid Sequences SPKINLSEDEKNYYIHADLPGLNKEQVKMELSDNDHKNKNKKENKEEKKNNKKYSRIECSYGRFERSFSIPENADVNSIQAKLENGVLEVTLPKIESPKVESKHTIQIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.21
3 0.19
4 0.14
5 0.16
6 0.19
7 0.21
8 0.21
9 0.23
10 0.21
11 0.21
12 0.22
13 0.21
14 0.2
15 0.19
16 0.19
17 0.21
18 0.25
19 0.33
20 0.34
21 0.36
22 0.41
23 0.44
24 0.5
25 0.54
26 0.6
27 0.6
28 0.66
29 0.72
30 0.77
31 0.83
32 0.86
33 0.88
34 0.89
35 0.91
36 0.92
37 0.91
38 0.87
39 0.84
40 0.81
41 0.8
42 0.77
43 0.69
44 0.64
45 0.58
46 0.55
47 0.55
48 0.48
49 0.43
50 0.34
51 0.31
52 0.29
53 0.28
54 0.25
55 0.2
56 0.21
57 0.18
58 0.19
59 0.2
60 0.18
61 0.17
62 0.14
63 0.13
64 0.11
65 0.11
66 0.1
67 0.09
68 0.09
69 0.09
70 0.11
71 0.1
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.07
80 0.07
81 0.1
82 0.11
83 0.13
84 0.19
85 0.28
86 0.31
87 0.36
88 0.41
89 0.43