Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8ZWM1

Protein Details
Accession G8ZWM1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
70-100STSGWRDARHHNYKKAKKMKNSKKKVSFTKFHydrophilic
NLS Segment(s)
PositionSequence
78-95RHHNYKKAKKMKNSKKKV
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG tdl:TDEL_0F02040  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRAKSHLAAKSVKRRNEFQKVVDARAERVSEKLKQDLMAQKMKELKDGTSMDIDTKKDDDESKKVSTSGWRDARHHNYKKAKKMKNSKKKVSFTKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.62
3 0.66
4 0.61
5 0.64
6 0.69
7 0.73
8 0.68
9 0.6
10 0.62
11 0.58
12 0.56
13 0.53
14 0.45
15 0.36
16 0.35
17 0.34
18 0.24
19 0.24
20 0.25
21 0.24
22 0.26
23 0.27
24 0.24
25 0.23
26 0.28
27 0.31
28 0.32
29 0.33
30 0.3
31 0.3
32 0.34
33 0.34
34 0.33
35 0.27
36 0.22
37 0.23
38 0.24
39 0.22
40 0.18
41 0.18
42 0.16
43 0.18
44 0.18
45 0.13
46 0.13
47 0.12
48 0.12
49 0.16
50 0.19
51 0.22
52 0.26
53 0.27
54 0.27
55 0.27
56 0.27
57 0.3
58 0.31
59 0.36
60 0.39
61 0.41
62 0.43
63 0.52
64 0.61
65 0.65
66 0.67
67 0.67
68 0.71
69 0.76
70 0.83
71 0.84
72 0.83
73 0.83
74 0.87
75 0.89
76 0.89
77 0.91
78 0.92
79 0.91
80 0.92