Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NL93

Protein Details
Accession A0A1Y3NL93    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
240-260LRSAKFHIRKQKYKEICNTGNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011043  Gal_Oxase/kelch_b-propeller  
IPR015915  Kelch-typ_b-propeller  
Pfam View protein in Pfam  
PF13415  Kelch_3  
Amino Acid Sequences MVIEPKSQMIYVFGGRTQAKNISEDSYSGLYSYSIKEDKWRLLRSDTNQPDNTVQLKSRIGHSMLLNPETNELYIFAGKRYKDFSNERKKNYLSDFYIYRIDEDCVIEVSRNYTMLGGPDAGFTQRATMDIELGELYMLSGLLSERNSNVETVKNILWMYNIKKNKWTKIYQNVNFGSEYNNRVSDKEPCTRFASQLVYDTKRKVQYLFGGNPGEINDPCLRLNDFWELKLERPSNEDILRSAKFHIRKQKYKEICNTGNYLQALKYLQNNISEVVNHNDENESKEFRELTQFLFDIQKTPNSNKKDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.26
4 0.27
5 0.3
6 0.29
7 0.29
8 0.31
9 0.28
10 0.27
11 0.26
12 0.26
13 0.21
14 0.2
15 0.17
16 0.16
17 0.13
18 0.14
19 0.15
20 0.17
21 0.17
22 0.17
23 0.24
24 0.29
25 0.37
26 0.44
27 0.47
28 0.45
29 0.5
30 0.57
31 0.56
32 0.62
33 0.6
34 0.6
35 0.56
36 0.56
37 0.51
38 0.47
39 0.44
40 0.36
41 0.3
42 0.26
43 0.29
44 0.27
45 0.28
46 0.29
47 0.28
48 0.29
49 0.29
50 0.31
51 0.31
52 0.32
53 0.3
54 0.26
55 0.26
56 0.23
57 0.21
58 0.15
59 0.12
60 0.1
61 0.12
62 0.12
63 0.12
64 0.16
65 0.16
66 0.18
67 0.22
68 0.22
69 0.27
70 0.36
71 0.44
72 0.51
73 0.59
74 0.62
75 0.65
76 0.64
77 0.63
78 0.6
79 0.56
80 0.48
81 0.44
82 0.4
83 0.35
84 0.38
85 0.32
86 0.28
87 0.22
88 0.19
89 0.17
90 0.16
91 0.14
92 0.11
93 0.11
94 0.1
95 0.09
96 0.1
97 0.09
98 0.09
99 0.09
100 0.08
101 0.08
102 0.08
103 0.09
104 0.08
105 0.07
106 0.07
107 0.07
108 0.07
109 0.08
110 0.07
111 0.07
112 0.06
113 0.07
114 0.08
115 0.08
116 0.08
117 0.07
118 0.08
119 0.06
120 0.06
121 0.05
122 0.04
123 0.03
124 0.03
125 0.03
126 0.02
127 0.02
128 0.02
129 0.04
130 0.04
131 0.05
132 0.05
133 0.07
134 0.08
135 0.08
136 0.09
137 0.09
138 0.09
139 0.11
140 0.11
141 0.11
142 0.11
143 0.1
144 0.11
145 0.13
146 0.16
147 0.21
148 0.24
149 0.24
150 0.31
151 0.36
152 0.41
153 0.45
154 0.46
155 0.47
156 0.54
157 0.64
158 0.6
159 0.64
160 0.58
161 0.53
162 0.48
163 0.4
164 0.34
165 0.26
166 0.25
167 0.18
168 0.2
169 0.19
170 0.19
171 0.21
172 0.25
173 0.27
174 0.32
175 0.32
176 0.33
177 0.37
178 0.37
179 0.37
180 0.32
181 0.31
182 0.24
183 0.29
184 0.31
185 0.3
186 0.31
187 0.33
188 0.35
189 0.35
190 0.35
191 0.3
192 0.28
193 0.31
194 0.36
195 0.36
196 0.36
197 0.34
198 0.32
199 0.31
200 0.29
201 0.25
202 0.17
203 0.18
204 0.15
205 0.15
206 0.16
207 0.17
208 0.17
209 0.15
210 0.18
211 0.22
212 0.22
213 0.21
214 0.26
215 0.26
216 0.26
217 0.34
218 0.33
219 0.25
220 0.28
221 0.31
222 0.31
223 0.31
224 0.3
225 0.24
226 0.27
227 0.28
228 0.25
229 0.25
230 0.26
231 0.3
232 0.37
233 0.46
234 0.51
235 0.59
236 0.66
237 0.74
238 0.76
239 0.79
240 0.82
241 0.8
242 0.76
243 0.71
244 0.68
245 0.58
246 0.55
247 0.47
248 0.39
249 0.29
250 0.26
251 0.24
252 0.21
253 0.24
254 0.23
255 0.25
256 0.26
257 0.27
258 0.26
259 0.25
260 0.24
261 0.22
262 0.23
263 0.24
264 0.21
265 0.21
266 0.23
267 0.22
268 0.26
269 0.27
270 0.25
271 0.23
272 0.26
273 0.26
274 0.25
275 0.33
276 0.29
277 0.28
278 0.3
279 0.29
280 0.28
281 0.33
282 0.31
283 0.27
284 0.28
285 0.32
286 0.31
287 0.39
288 0.46