Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NB30

Protein Details
Accession A0A1Y3NB30    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
76-96MEQQKRVQEFQEKRRKRKYGSHydrophilic
NLS Segment(s)
PositionSequence
88-93KRRKRK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004217  Tim10-like  
IPR035427  Tim10-like_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF02953  zf-Tim10_DDP  
Amino Acid Sequences MDNRMQMQMAEQEFELVTELLRKITNRCYEKCHDKTYASGDATTRESLCMDKCVMKYFEVNKNVNDRLQAASQAKMEQQKRVQEFQEKRRKRKYGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.09
4 0.08
5 0.09
6 0.1
7 0.1
8 0.12
9 0.13
10 0.15
11 0.23
12 0.32
13 0.35
14 0.37
15 0.42
16 0.48
17 0.58
18 0.59
19 0.57
20 0.51
21 0.47
22 0.47
23 0.46
24 0.44
25 0.34
26 0.3
27 0.25
28 0.23
29 0.24
30 0.22
31 0.17
32 0.11
33 0.11
34 0.11
35 0.11
36 0.11
37 0.1
38 0.12
39 0.13
40 0.17
41 0.17
42 0.17
43 0.21
44 0.25
45 0.32
46 0.35
47 0.36
48 0.35
49 0.4
50 0.4
51 0.37
52 0.33
53 0.26
54 0.22
55 0.22
56 0.25
57 0.21
58 0.21
59 0.21
60 0.22
61 0.24
62 0.29
63 0.3
64 0.32
65 0.36
66 0.43
67 0.47
68 0.51
69 0.52
70 0.54
71 0.61
72 0.64
73 0.7
74 0.71
75 0.76
76 0.82