Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MPS3

Protein Details
Accession A0A1Y3MPS3   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
130-159GIKKCKDKYECWKYDRERKKYEIKKKKKEKBasic
NLS Segment(s)
PositionSequence
146-159ERKKYEIKKKKKEK
Subcellular Location(s) nucl 14, cyto_nucl 10.833, cyto 5.5, cyto_mito 5.166, mito 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYDVINEKVYSNYESSYNLPVVKICPNLSDPTIKNGNLKLNICSTPKCTKDEDCLSGKCSSETCIKGEKIIYMCSGQRPSYFLRCGKVAGMSAVSVELDSNDKVLIFVIVIIIMIGTAACMLLSIAAYFGIKKCKDKYECWKYDRERKKYEIKKKKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.23
4 0.22
5 0.2
6 0.19
7 0.19
8 0.2
9 0.23
10 0.24
11 0.21
12 0.21
13 0.23
14 0.26
15 0.27
16 0.31
17 0.27
18 0.3
19 0.34
20 0.32
21 0.33
22 0.34
23 0.38
24 0.37
25 0.37
26 0.33
27 0.32
28 0.35
29 0.34
30 0.32
31 0.32
32 0.34
33 0.35
34 0.36
35 0.36
36 0.35
37 0.4
38 0.44
39 0.43
40 0.4
41 0.39
42 0.38
43 0.36
44 0.34
45 0.26
46 0.21
47 0.19
48 0.2
49 0.2
50 0.2
51 0.23
52 0.23
53 0.23
54 0.24
55 0.24
56 0.19
57 0.19
58 0.17
59 0.14
60 0.14
61 0.16
62 0.18
63 0.15
64 0.14
65 0.16
66 0.17
67 0.21
68 0.24
69 0.22
70 0.22
71 0.22
72 0.22
73 0.2
74 0.19
75 0.14
76 0.11
77 0.1
78 0.08
79 0.07
80 0.06
81 0.06
82 0.05
83 0.04
84 0.04
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.06
92 0.05
93 0.04
94 0.04
95 0.03
96 0.03
97 0.03
98 0.03
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.05
116 0.07
117 0.15
118 0.18
119 0.23
120 0.28
121 0.37
122 0.43
123 0.51
124 0.6
125 0.64
126 0.71
127 0.7
128 0.75
129 0.74
130 0.8
131 0.82
132 0.8
133 0.77
134 0.75
135 0.81
136 0.82
137 0.84
138 0.85
139 0.86