Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZSI2

Protein Details
Accession G8ZSI2   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-89EDAKHIQDKKPKPKPKLVKKDSTTKGBasic
NLS Segment(s)
PositionSequence
72-116KKPKPKPKLVKKDSTTKGIPTLKSEKLAKDDPMSKFKVAKKRSKK
Subcellular Location(s) nucl 18, cyto 6, mito 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR019339  CIR_N_dom  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0008380  P:RNA splicing  
KEGG tdl:TDEL_0C05850  -  
Pfam View protein in Pfam  
PF10197  Cir_N  
Amino Acid Sequences MAGSSDLNLLKSWNPKLQKNKAKVSKVEEDAIEEERKIQQKQKEKELQDLASGKGKTGLEWMYEDAKHIQDKKPKPKPKLVKKDSTTKGIPTLKSEKLAKDDPMSKFKVAKKRSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.44
3 0.54
4 0.63
5 0.69
6 0.7
7 0.76
8 0.78
9 0.79
10 0.77
11 0.74
12 0.71
13 0.65
14 0.6
15 0.49
16 0.43
17 0.38
18 0.35
19 0.28
20 0.2
21 0.18
22 0.2
23 0.24
24 0.23
25 0.27
26 0.31
27 0.41
28 0.46
29 0.55
30 0.59
31 0.56
32 0.61
33 0.6
34 0.53
35 0.47
36 0.43
37 0.34
38 0.31
39 0.29
40 0.22
41 0.21
42 0.2
43 0.16
44 0.17
45 0.16
46 0.11
47 0.12
48 0.14
49 0.12
50 0.12
51 0.13
52 0.12
53 0.13
54 0.15
55 0.17
56 0.22
57 0.28
58 0.38
59 0.48
60 0.57
61 0.64
62 0.68
63 0.75
64 0.81
65 0.83
66 0.86
67 0.83
68 0.83
69 0.79
70 0.83
71 0.77
72 0.72
73 0.63
74 0.54
75 0.55
76 0.5
77 0.46
78 0.42
79 0.44
80 0.4
81 0.44
82 0.45
83 0.4
84 0.41
85 0.43
86 0.4
87 0.41
88 0.46
89 0.45
90 0.49
91 0.5
92 0.46
93 0.49
94 0.53
95 0.57
96 0.58