Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MYT7

Protein Details
Accession A0A1Y3MYT7   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
39-71KKESKRKKVSQACENCRKKRRKCSGDRPKCITCBasic
78-108CYYNPCIKKRGPQQKRKKRKYKKRDKENKGIBasic
NLS Segment(s)
PositionSequence
85-108KKRGPQQKRKKRKYKKRDKENKGI
Subcellular Location(s) nucl 24, cyto_nucl 16.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSNDNNLFKFNQNVSEMLNFKYEISVKSNSNSNDNEIEKKESKRKKVSQACENCRKKRRKCSGDRPKCITCQQNNYICYYNPCIKKRGPQQKRKKRKYKKRDKENKGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.3
4 0.26
5 0.26
6 0.21
7 0.19
8 0.21
9 0.2
10 0.17
11 0.2
12 0.22
13 0.21
14 0.23
15 0.29
16 0.27
17 0.3
18 0.29
19 0.28
20 0.29
21 0.3
22 0.31
23 0.28
24 0.33
25 0.32
26 0.36
27 0.42
28 0.45
29 0.51
30 0.58
31 0.63
32 0.67
33 0.73
34 0.75
35 0.76
36 0.79
37 0.79
38 0.79
39 0.81
40 0.78
41 0.78
42 0.8
43 0.79
44 0.8
45 0.82
46 0.82
47 0.84
48 0.87
49 0.89
50 0.91
51 0.9
52 0.86
53 0.79
54 0.73
55 0.68
56 0.65
57 0.6
58 0.58
59 0.57
60 0.57
61 0.55
62 0.54
63 0.5
64 0.42
65 0.39
66 0.37
67 0.37
68 0.38
69 0.4
70 0.41
71 0.42
72 0.5
73 0.58
74 0.63
75 0.66
76 0.69
77 0.78
78 0.85
79 0.93
80 0.95
81 0.95
82 0.95
83 0.96
84 0.97
85 0.97
86 0.97
87 0.97
88 0.97