Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NDV3

Protein Details
Accession A0A1Y3NDV3   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
110-130DVEHPRFKKHMKKLKTMPDTEBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 13, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037665  Nucleoporin_S59-like  
IPR007230  Nup98_auto-Pept-S59_dom  
IPR036903  Nup98_auto-Pept-S59_dom_sf  
Gene Ontology GO:0005643  C:nuclear pore  
GO:0017056  F:structural constituent of nuclear pore  
GO:0051028  P:mRNA transport  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF04096  Nucleoporin2  
PROSITE View protein in PROSITE  
PS51434  NUP_C  
Amino Acid Sequences DYIVSPSLSEMNRMTNEELKHVKNLIVTCPGIGSVHFLEPVDLISASPTHDRNGIVKIFGSVIIIEPKVCTVYPGEENKPPIGQGLNVPAHIELLKCWTMDKTTQKPIIDVEHPRFKKHMKKLKTMPDTEFISFDIETGCWSFNVEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.29
4 0.33
5 0.37
6 0.34
7 0.35
8 0.33
9 0.31
10 0.3
11 0.3
12 0.27
13 0.27
14 0.25
15 0.21
16 0.2
17 0.19
18 0.15
19 0.14
20 0.14
21 0.11
22 0.11
23 0.12
24 0.11
25 0.11
26 0.11
27 0.11
28 0.09
29 0.07
30 0.06
31 0.06
32 0.07
33 0.08
34 0.1
35 0.11
36 0.1
37 0.12
38 0.13
39 0.14
40 0.18
41 0.17
42 0.15
43 0.14
44 0.14
45 0.12
46 0.11
47 0.1
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.08
60 0.13
61 0.17
62 0.19
63 0.2
64 0.22
65 0.22
66 0.22
67 0.19
68 0.15
69 0.12
70 0.1
71 0.09
72 0.14
73 0.14
74 0.14
75 0.14
76 0.13
77 0.14
78 0.13
79 0.12
80 0.06
81 0.09
82 0.1
83 0.1
84 0.11
85 0.11
86 0.13
87 0.19
88 0.27
89 0.29
90 0.36
91 0.42
92 0.42
93 0.42
94 0.42
95 0.4
96 0.37
97 0.38
98 0.37
99 0.42
100 0.43
101 0.44
102 0.46
103 0.48
104 0.53
105 0.57
106 0.6
107 0.57
108 0.67
109 0.74
110 0.81
111 0.83
112 0.78
113 0.72
114 0.68
115 0.65
116 0.55
117 0.47
118 0.37
119 0.3
120 0.25
121 0.21
122 0.16
123 0.11
124 0.12
125 0.12
126 0.12
127 0.09