Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NLL0

Protein Details
Accession A0A1Y3NLL0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-98CCYFYEMKKKEKEKQLNSESNAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, vacu 4, mito 3, E.R. 3, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYSIYALVIFPGNAINIISAIGLVIGVKKDIFILVAQYLILGAFALAYKIHLITSISDTIILVAFAIIDVVFYIIVCCYFYEMKKKEKEKQLNSESNAVPDISVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.06
6 0.05
7 0.04
8 0.04
9 0.03
10 0.03
11 0.04
12 0.04
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.06
19 0.05
20 0.07
21 0.06
22 0.07
23 0.06
24 0.06
25 0.06
26 0.05
27 0.05
28 0.03
29 0.02
30 0.02
31 0.02
32 0.03
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.07
48 0.06
49 0.04
50 0.03
51 0.03
52 0.02
53 0.03
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.03
62 0.03
63 0.04
64 0.04
65 0.07
66 0.09
67 0.12
68 0.22
69 0.26
70 0.34
71 0.43
72 0.51
73 0.57
74 0.66
75 0.74
76 0.74
77 0.8
78 0.82
79 0.82
80 0.78
81 0.76
82 0.66
83 0.58
84 0.5
85 0.39