Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NGV5

Protein Details
Accession A0A1Y3NGV5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
110-130LLDVKNKKKLQPLIRKRFQRAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR004352  GH114_TIM-barrel  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF03537  Glyco_hydro_114  
Amino Acid Sequences MKYILPVTLLASSLLVNVEAARWKPKPGLTWDYLLGGNKNDIKNSDRDVAIFDLEYAEAMVPILHKRGQKAVCYFSGGTTEYNSSRPDIKDYKKAGIEIKGTNDGWGNYLLDVKNKKKLQPLIRKRFQRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.06
4 0.06
5 0.07
6 0.1
7 0.11
8 0.17
9 0.18
10 0.2
11 0.24
12 0.27
13 0.31
14 0.36
15 0.41
16 0.38
17 0.4
18 0.38
19 0.36
20 0.35
21 0.3
22 0.24
23 0.17
24 0.18
25 0.2
26 0.19
27 0.18
28 0.19
29 0.2
30 0.22
31 0.26
32 0.26
33 0.21
34 0.21
35 0.22
36 0.2
37 0.18
38 0.15
39 0.11
40 0.08
41 0.08
42 0.07
43 0.05
44 0.04
45 0.03
46 0.03
47 0.03
48 0.04
49 0.04
50 0.06
51 0.09
52 0.1
53 0.11
54 0.18
55 0.2
56 0.24
57 0.27
58 0.29
59 0.26
60 0.29
61 0.28
62 0.22
63 0.21
64 0.18
65 0.15
66 0.13
67 0.14
68 0.12
69 0.14
70 0.14
71 0.14
72 0.17
73 0.17
74 0.22
75 0.28
76 0.31
77 0.39
78 0.41
79 0.45
80 0.44
81 0.45
82 0.43
83 0.4
84 0.4
85 0.34
86 0.34
87 0.33
88 0.31
89 0.3
90 0.28
91 0.23
92 0.2
93 0.19
94 0.16
95 0.11
96 0.15
97 0.15
98 0.2
99 0.27
100 0.3
101 0.38
102 0.42
103 0.46
104 0.51
105 0.6
106 0.64
107 0.68
108 0.75
109 0.77
110 0.83