Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NYT8

Protein Details
Accession A0A1Y3NYT8    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
34-57VSAVNIKKKRQYRQYMNRRGGFNRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.5, nucl 12.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences LVNENEDIEAQMMAIMGFGGFDSTKGKHVPGTDVSAVNIKKKRQYRQYMNRRGGFNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.04
9 0.06
10 0.07
11 0.1
12 0.1
13 0.11
14 0.12
15 0.13
16 0.16
17 0.15
18 0.19
19 0.19
20 0.18
21 0.18
22 0.22
23 0.22
24 0.26
25 0.28
26 0.27
27 0.33
28 0.41
29 0.5
30 0.55
31 0.65
32 0.7
33 0.77
34 0.85
35 0.88
36 0.9
37 0.87