Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NLP9

Protein Details
Accession A0A1Y3NLP9    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-20RKTVKRKKTKNNSKDSNSVLHydrophilic
53-76QEAKKIKREILRKERKKNKQIIYIHydrophilic
NLS Segment(s)
PositionSequence
55-71AKKIKREILRKERKKNK
Subcellular Location(s) nucl 14.5, mito_nucl 12.5, mito 9.5
Family & Domain DBs
Amino Acid Sequences RKTVKRKKTKNNSKDSNSVLASTSNTPVVLVPKLNSIIEHEFANKRVTRSMQQEAKKIKREILRKERKKNKQIIYIEISDDDDNDEAEKNTALNENKNKKLKLKSNDNVDTKKNKSAFDSTDNQNSTYNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.79
3 0.75
4 0.64
5 0.55
6 0.45
7 0.36
8 0.31
9 0.25
10 0.22
11 0.16
12 0.15
13 0.14
14 0.14
15 0.15
16 0.14
17 0.13
18 0.12
19 0.14
20 0.16
21 0.16
22 0.15
23 0.17
24 0.18
25 0.18
26 0.18
27 0.19
28 0.19
29 0.2
30 0.25
31 0.22
32 0.2
33 0.22
34 0.25
35 0.27
36 0.31
37 0.38
38 0.41
39 0.42
40 0.48
41 0.54
42 0.58
43 0.59
44 0.54
45 0.52
46 0.51
47 0.55
48 0.58
49 0.61
50 0.65
51 0.67
52 0.77
53 0.82
54 0.85
55 0.87
56 0.86
57 0.81
58 0.8
59 0.73
60 0.68
61 0.62
62 0.53
63 0.45
64 0.36
65 0.31
66 0.21
67 0.18
68 0.13
69 0.09
70 0.07
71 0.07
72 0.08
73 0.06
74 0.07
75 0.07
76 0.06
77 0.07
78 0.12
79 0.13
80 0.2
81 0.29
82 0.37
83 0.45
84 0.52
85 0.54
86 0.56
87 0.64
88 0.66
89 0.67
90 0.7
91 0.69
92 0.73
93 0.79
94 0.78
95 0.74
96 0.71
97 0.7
98 0.63
99 0.64
100 0.57
101 0.5
102 0.48
103 0.5
104 0.48
105 0.47
106 0.49
107 0.47
108 0.52
109 0.52
110 0.48