Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N6P7

Protein Details
Accession A0A1Y3N6P7   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
34-56VVFPTKRSLKKNKINKNNYTNDYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, mito 2
Family & Domain DBs
Amino Acid Sequences MIFMNDKSKNSVRWAEAIAEEFNFEWDQEPINSVVFPTKRSLKKNKINKNNYTNDYFSTNLSNEINSAVSNKIFNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.34
3 0.31
4 0.3
5 0.25
6 0.18
7 0.17
8 0.14
9 0.13
10 0.11
11 0.1
12 0.08
13 0.08
14 0.09
15 0.08
16 0.1
17 0.09
18 0.09
19 0.09
20 0.08
21 0.12
22 0.11
23 0.12
24 0.14
25 0.21
26 0.26
27 0.33
28 0.43
29 0.49
30 0.58
31 0.67
32 0.74
33 0.78
34 0.82
35 0.84
36 0.84
37 0.82
38 0.76
39 0.71
40 0.62
41 0.53
42 0.47
43 0.39
44 0.31
45 0.26
46 0.23
47 0.21
48 0.2
49 0.18
50 0.14
51 0.15
52 0.14
53 0.11
54 0.12
55 0.12
56 0.12