Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N4X9

Protein Details
Accession A0A1Y3N4X9   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
117-144EIDTTSSSSRRQRQKKKIILLERWRLSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, E.R. 5, nucl 4, golg 4, plas 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018731  Atg13_N  
IPR036570  HORMA_dom_sf  
Gene Ontology GO:1990316  C:Atg1/ULK1 kinase complex  
GO:0016020  C:membrane  
GO:0006914  P:autophagy  
Pfam View protein in Pfam  
PF10033  ATG13  
Amino Acid Sequences MDVKKIRYYYTKFLFKIFSNCNTVKVSVSRKGTQKRKQMVVVIVVVVVVVVVVFNIRLHDILRLEEEPIISSYKKIPIPDFMPLIIDIYLDISPCLTTKKVYIRNEEDKNNKDNFVEIDTTSSSSRRQRQKKKIILLERWRLSLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.51
3 0.52
4 0.48
5 0.44
6 0.43
7 0.42
8 0.43
9 0.41
10 0.39
11 0.33
12 0.34
13 0.35
14 0.35
15 0.4
16 0.42
17 0.48
18 0.57
19 0.65
20 0.67
21 0.71
22 0.72
23 0.72
24 0.71
25 0.68
26 0.61
27 0.54
28 0.46
29 0.36
30 0.27
31 0.21
32 0.16
33 0.1
34 0.07
35 0.03
36 0.02
37 0.01
38 0.01
39 0.02
40 0.02
41 0.02
42 0.03
43 0.04
44 0.04
45 0.05
46 0.07
47 0.08
48 0.08
49 0.11
50 0.11
51 0.11
52 0.11
53 0.11
54 0.09
55 0.1
56 0.11
57 0.08
58 0.09
59 0.09
60 0.13
61 0.15
62 0.16
63 0.16
64 0.18
65 0.2
66 0.22
67 0.21
68 0.17
69 0.16
70 0.15
71 0.15
72 0.11
73 0.09
74 0.06
75 0.06
76 0.07
77 0.06
78 0.05
79 0.05
80 0.05
81 0.06
82 0.08
83 0.07
84 0.08
85 0.12
86 0.21
87 0.3
88 0.34
89 0.42
90 0.48
91 0.57
92 0.62
93 0.65
94 0.65
95 0.61
96 0.62
97 0.56
98 0.49
99 0.41
100 0.37
101 0.3
102 0.26
103 0.23
104 0.18
105 0.18
106 0.18
107 0.2
108 0.19
109 0.19
110 0.2
111 0.26
112 0.35
113 0.43
114 0.53
115 0.62
116 0.72
117 0.82
118 0.87
119 0.89
120 0.91
121 0.9
122 0.9
123 0.89
124 0.89
125 0.81