Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AMB7

Protein Details
Accession G3AMB7    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
94-118KITTSPTIKKTKKKNKCSFKSCSNAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
KEGG spaa:SPAPADRAFT_137676  -  
Pfam View protein in Pfam  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
PS51039  ZF_AN1  
CDD cd17039  Ubl_ubiquitin_like  
Amino Acid Sequences MKVTIRLSTEISYTITIPDNATVEDLKNSAKVGCPVTSTLPPDFKLIYNGEKLQPHYQPLSAFGITTNDVTVILMSNVSDTPPVLSPSSSQTEKITTSPTIKKTKKKNKCSFKSCSNAPLRMVGTCSHCQGKFCAKHRLLEDHLCTGLQFCKDDAHQKNAMKLQSESTIASRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.15
5 0.15
6 0.15
7 0.14
8 0.15
9 0.14
10 0.13
11 0.13
12 0.14
13 0.13
14 0.12
15 0.13
16 0.12
17 0.13
18 0.16
19 0.18
20 0.18
21 0.18
22 0.19
23 0.23
24 0.25
25 0.26
26 0.26
27 0.26
28 0.26
29 0.26
30 0.26
31 0.23
32 0.23
33 0.22
34 0.22
35 0.23
36 0.24
37 0.26
38 0.27
39 0.3
40 0.31
41 0.31
42 0.3
43 0.28
44 0.28
45 0.24
46 0.25
47 0.25
48 0.19
49 0.18
50 0.15
51 0.15
52 0.14
53 0.13
54 0.1
55 0.07
56 0.07
57 0.06
58 0.06
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.06
70 0.08
71 0.07
72 0.08
73 0.08
74 0.12
75 0.16
76 0.15
77 0.15
78 0.14
79 0.16
80 0.17
81 0.17
82 0.16
83 0.14
84 0.19
85 0.23
86 0.29
87 0.37
88 0.42
89 0.49
90 0.57
91 0.67
92 0.72
93 0.79
94 0.83
95 0.84
96 0.89
97 0.89
98 0.85
99 0.83
100 0.79
101 0.71
102 0.69
103 0.64
104 0.57
105 0.5
106 0.47
107 0.39
108 0.32
109 0.31
110 0.24
111 0.24
112 0.23
113 0.24
114 0.25
115 0.25
116 0.25
117 0.28
118 0.35
119 0.38
120 0.42
121 0.5
122 0.46
123 0.51
124 0.54
125 0.58
126 0.53
127 0.52
128 0.5
129 0.43
130 0.42
131 0.36
132 0.32
133 0.26
134 0.25
135 0.19
136 0.17
137 0.14
138 0.17
139 0.2
140 0.3
141 0.33
142 0.36
143 0.41
144 0.43
145 0.49
146 0.52
147 0.52
148 0.46
149 0.42
150 0.39
151 0.36
152 0.35
153 0.3