Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N7D4

Protein Details
Accession A0A1Y3N7D4   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
50-73MKECLLKTYKLKKNPEERNQRNETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 9.833, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MSDLFNENILLQHRFMSMQVKIQGEGAKKVQELIIENEEGNKTYPTLAEMKECLLKTYKLKKNPEERNQRNET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.18
4 0.16
5 0.2
6 0.24
7 0.24
8 0.23
9 0.25
10 0.27
11 0.24
12 0.26
13 0.22
14 0.19
15 0.18
16 0.18
17 0.17
18 0.15
19 0.15
20 0.16
21 0.15
22 0.14
23 0.14
24 0.15
25 0.14
26 0.13
27 0.12
28 0.09
29 0.07
30 0.07
31 0.07
32 0.08
33 0.11
34 0.11
35 0.13
36 0.13
37 0.15
38 0.19
39 0.19
40 0.19
41 0.19
42 0.22
43 0.29
44 0.39
45 0.45
46 0.49
47 0.58
48 0.66
49 0.73
50 0.81
51 0.83
52 0.84
53 0.84