Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N4Z7

Protein Details
Accession A0A1Y3N4Z7    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-84KDYLSEKRKKLNKNQRYEISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR001619  Sec1-like  
IPR027482  Sec1-like_dom2  
IPR036045  Sec1-like_sf  
Gene Ontology GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF00995  Sec1  
Amino Acid Sequences MREKMQLIMLFVLCSKTVSKTTLSNLCYDASIDEQKIYDLLNIEKQNNNVTISDDTITVKTTEFKDYLSEKRKKLNKNQRYEISDLSRYITPVKIIVRDVVKDKIKDKFFRHTNVTIANEALNEVKKPKAHKVLYDDVPLQSYKPTWAHRTNDKNIYDLRTYGSRIIIFILGGVTYAEMREVYEMVKEYNRDIIIGSTSIITPKTFMDDIYMLKTNIRSRNTVNLKKKLVRSYTVGKKKELERERKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.17
5 0.18
6 0.21
7 0.23
8 0.3
9 0.36
10 0.36
11 0.35
12 0.34
13 0.32
14 0.3
15 0.26
16 0.21
17 0.18
18 0.2
19 0.18
20 0.17
21 0.17
22 0.17
23 0.16
24 0.15
25 0.13
26 0.11
27 0.13
28 0.19
29 0.22
30 0.25
31 0.27
32 0.29
33 0.31
34 0.31
35 0.3
36 0.23
37 0.23
38 0.21
39 0.21
40 0.2
41 0.16
42 0.16
43 0.14
44 0.15
45 0.12
46 0.12
47 0.13
48 0.14
49 0.17
50 0.16
51 0.16
52 0.2
53 0.24
54 0.32
55 0.39
56 0.44
57 0.43
58 0.52
59 0.59
60 0.63
61 0.7
62 0.72
63 0.72
64 0.75
65 0.81
66 0.8
67 0.77
68 0.72
69 0.65
70 0.59
71 0.52
72 0.43
73 0.37
74 0.29
75 0.25
76 0.23
77 0.19
78 0.14
79 0.14
80 0.15
81 0.14
82 0.14
83 0.17
84 0.17
85 0.18
86 0.2
87 0.23
88 0.26
89 0.26
90 0.28
91 0.32
92 0.36
93 0.41
94 0.42
95 0.45
96 0.46
97 0.49
98 0.51
99 0.46
100 0.43
101 0.4
102 0.39
103 0.3
104 0.25
105 0.2
106 0.15
107 0.13
108 0.12
109 0.08
110 0.07
111 0.08
112 0.09
113 0.11
114 0.14
115 0.2
116 0.29
117 0.3
118 0.34
119 0.39
120 0.44
121 0.45
122 0.45
123 0.39
124 0.3
125 0.3
126 0.26
127 0.19
128 0.13
129 0.11
130 0.11
131 0.14
132 0.17
133 0.23
134 0.29
135 0.33
136 0.42
137 0.5
138 0.53
139 0.57
140 0.55
141 0.5
142 0.46
143 0.46
144 0.38
145 0.3
146 0.26
147 0.2
148 0.2
149 0.19
150 0.19
151 0.15
152 0.14
153 0.15
154 0.13
155 0.1
156 0.09
157 0.08
158 0.05
159 0.05
160 0.05
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.05
168 0.05
169 0.05
170 0.07
171 0.08
172 0.1
173 0.12
174 0.13
175 0.13
176 0.18
177 0.17
178 0.16
179 0.16
180 0.15
181 0.14
182 0.14
183 0.13
184 0.09
185 0.09
186 0.1
187 0.1
188 0.09
189 0.09
190 0.09
191 0.13
192 0.13
193 0.13
194 0.16
195 0.17
196 0.18
197 0.22
198 0.24
199 0.2
200 0.22
201 0.26
202 0.29
203 0.34
204 0.36
205 0.35
206 0.37
207 0.47
208 0.56
209 0.62
210 0.65
211 0.66
212 0.72
213 0.75
214 0.79
215 0.77
216 0.73
217 0.67
218 0.64
219 0.65
220 0.68
221 0.7
222 0.66
223 0.61
224 0.62
225 0.65
226 0.69
227 0.69