Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3MYZ9

Protein Details
Accession A0A1Y3MYZ9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
44-65GQEEPKKRRIIRKTLPKLNSNTHydrophilic
NLS Segment(s)
PositionSequence
49-55KKRRIIR
Subcellular Location(s) nucl 21, cyto_nucl 12.833, mito 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MDEDNETIENLFGFEDISETESERENENVVNGAPQNKPEAGAEGQEEPKKRRIIRKTLPKLNSNTYMKKMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.07
5 0.07
6 0.08
7 0.09
8 0.11
9 0.12
10 0.12
11 0.13
12 0.12
13 0.12
14 0.11
15 0.11
16 0.09
17 0.09
18 0.08
19 0.11
20 0.11
21 0.11
22 0.12
23 0.12
24 0.13
25 0.11
26 0.14
27 0.11
28 0.12
29 0.13
30 0.14
31 0.17
32 0.19
33 0.22
34 0.22
35 0.28
36 0.34
37 0.37
38 0.45
39 0.5
40 0.58
41 0.66
42 0.74
43 0.78
44 0.82
45 0.83
46 0.81
47 0.78
48 0.74
49 0.73
50 0.69
51 0.65