Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8ZS48

Protein Details
Accession G8ZS48    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
66-92RDVESLKKRQRKMKKRAVRANKVENDKBasic
153-181QNSGVESAKRSKKRRKTVKKFKEDIHPTVHydrophilic
NLS Segment(s)
PositionSequence
38-40RPK
71-85LKKRQRKMKKRAVRA
160-174AKRSKKRRKTVKKFK
Subcellular Location(s) nucl 18.5, mito_nucl 12.666, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031404  Rrt14  
Gene Ontology GO:0005730  C:nucleolus  
KEGG tdl:TDEL_0C04510  -  
Pfam View protein in Pfam  
PF17075  RRT14  
Amino Acid Sequences MSSSSKHAELQANIAVNSLLSTLLPGAKKISSGIDGRRPKSSTKVRGSKAQLIDRNLKKIVELQERDVESLKKRQRKMKKRAVRANKVENDKIQQLAKLSVLERHKKVGTLTVKEQKYLNKLVNRNVRTARSLDLEEEDKEALRELQQKIISQNSGVESAKRSKKRRKTVKKFKEDIHPTVSDRRYPGLTPGLAPVGLSDEEDSSDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.23
3 0.17
4 0.15
5 0.11
6 0.07
7 0.05
8 0.05
9 0.06
10 0.1
11 0.11
12 0.11
13 0.13
14 0.13
15 0.14
16 0.15
17 0.16
18 0.16
19 0.2
20 0.26
21 0.33
22 0.41
23 0.42
24 0.47
25 0.47
26 0.46
27 0.51
28 0.56
29 0.56
30 0.58
31 0.65
32 0.63
33 0.7
34 0.73
35 0.72
36 0.69
37 0.67
38 0.62
39 0.58
40 0.64
41 0.58
42 0.57
43 0.5
44 0.43
45 0.35
46 0.35
47 0.39
48 0.38
49 0.37
50 0.36
51 0.4
52 0.4
53 0.41
54 0.37
55 0.31
56 0.25
57 0.32
58 0.36
59 0.38
60 0.43
61 0.52
62 0.61
63 0.69
64 0.77
65 0.79
66 0.81
67 0.84
68 0.89
69 0.9
70 0.89
71 0.86
72 0.85
73 0.81
74 0.77
75 0.68
76 0.6
77 0.52
78 0.43
79 0.37
80 0.28
81 0.22
82 0.18
83 0.16
84 0.15
85 0.13
86 0.12
87 0.15
88 0.2
89 0.24
90 0.24
91 0.26
92 0.25
93 0.25
94 0.25
95 0.28
96 0.27
97 0.26
98 0.32
99 0.37
100 0.37
101 0.37
102 0.38
103 0.34
104 0.33
105 0.34
106 0.33
107 0.32
108 0.35
109 0.42
110 0.49
111 0.48
112 0.49
113 0.48
114 0.44
115 0.39
116 0.38
117 0.32
118 0.26
119 0.25
120 0.21
121 0.19
122 0.19
123 0.17
124 0.17
125 0.15
126 0.12
127 0.12
128 0.11
129 0.09
130 0.11
131 0.17
132 0.17
133 0.23
134 0.24
135 0.26
136 0.28
137 0.31
138 0.28
139 0.22
140 0.22
141 0.18
142 0.2
143 0.18
144 0.17
145 0.18
146 0.26
147 0.34
148 0.41
149 0.49
150 0.56
151 0.66
152 0.76
153 0.84
154 0.87
155 0.9
156 0.93
157 0.95
158 0.95
159 0.91
160 0.86
161 0.86
162 0.82
163 0.76
164 0.71
165 0.63
166 0.55
167 0.58
168 0.55
169 0.48
170 0.42
171 0.4
172 0.36
173 0.34
174 0.36
175 0.33
176 0.31
177 0.28
178 0.29
179 0.27
180 0.24
181 0.23
182 0.18
183 0.14
184 0.14
185 0.14
186 0.12
187 0.1
188 0.12