Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NTH7

Protein Details
Accession A0A1Y3NTH7   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-29ENTGRPKSKSAVRKGKKEWKKNIDITDVHydrophilic
90-120QVEKINKRKAERNIKKVNKKKKTGSIIARDLHydrophilic
NLS Segment(s)
PositionSequence
6-22RPKSKSAVRKGKKEWKK
93-112KINKRKAERNIKKVNKKKKT
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MENTGRPKSKSAVRKGKKEWKKNIDITDVENDLEEIRKEEIAFGGKIEEQANEDLFTIDVEGDSEAFGSKHNKDSKNVSRFNLSKYTKEQVEKINKRKAERNIKKVNKKKKTGSIIARDLWEEAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.81
3 0.86
4 0.87
5 0.88
6 0.88
7 0.86
8 0.88
9 0.85
10 0.8
11 0.76
12 0.67
13 0.6
14 0.54
15 0.45
16 0.35
17 0.28
18 0.22
19 0.16
20 0.16
21 0.12
22 0.09
23 0.09
24 0.1
25 0.1
26 0.1
27 0.11
28 0.12
29 0.12
30 0.1
31 0.11
32 0.1
33 0.12
34 0.12
35 0.1
36 0.09
37 0.1
38 0.1
39 0.1
40 0.1
41 0.08
42 0.08
43 0.07
44 0.06
45 0.05
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.05
55 0.08
56 0.09
57 0.16
58 0.23
59 0.25
60 0.27
61 0.37
62 0.45
63 0.51
64 0.54
65 0.49
66 0.5
67 0.5
68 0.51
69 0.52
70 0.45
71 0.4
72 0.41
73 0.44
74 0.41
75 0.42
76 0.42
77 0.41
78 0.5
79 0.56
80 0.6
81 0.63
82 0.63
83 0.66
84 0.7
85 0.71
86 0.71
87 0.72
88 0.74
89 0.76
90 0.83
91 0.89
92 0.91
93 0.92
94 0.9
95 0.89
96 0.88
97 0.87
98 0.86
99 0.85
100 0.85
101 0.83
102 0.8
103 0.74
104 0.66
105 0.57