Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MUN3

Protein Details
Accession A0A1Y3MUN3    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-48NYSSQSPSHKPKKLKPRRRVVFVNPDDHydrophilic
177-197LLNGAFPQKRRDKKEKELLKKBasic
NLS Segment(s)
PositionSequence
29-40SHKPKKLKPRRR
172-197DRKKKLLNGAFPQKRRDKKEKELLKK
Subcellular Location(s) nucl 15, mito_nucl 12.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
CDD cd05162  PWWP  
Amino Acid Sequences MFRKDINTMIPQKFHKKIGKINYSSQSPSHKPKKLKPRRRVVFVNPDDDHCLYWWPALVVPEIEYNLFKQSYDDSNNFKIPNENEILVCYFEDGSFSVIPESDSVPFNPNTLPYTKYLSDPNISQAFKNDKAVKLAKLYLETGEIPSTFLWLKDVPTEDKDDKNNDRNKMEDRKKKLLNGAFPQKRRDKKEKELLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.6
3 0.59
4 0.63
5 0.68
6 0.72
7 0.68
8 0.72
9 0.7
10 0.67
11 0.62
12 0.57
13 0.55
14 0.51
15 0.56
16 0.58
17 0.59
18 0.63
19 0.69
20 0.77
21 0.8
22 0.84
23 0.84
24 0.86
25 0.87
26 0.87
27 0.86
28 0.84
29 0.84
30 0.77
31 0.75
32 0.64
33 0.58
34 0.54
35 0.46
36 0.37
37 0.27
38 0.24
39 0.16
40 0.16
41 0.14
42 0.1
43 0.11
44 0.11
45 0.11
46 0.09
47 0.1
48 0.1
49 0.1
50 0.1
51 0.09
52 0.09
53 0.11
54 0.11
55 0.1
56 0.1
57 0.12
58 0.16
59 0.2
60 0.22
61 0.24
62 0.27
63 0.3
64 0.3
65 0.27
66 0.27
67 0.23
68 0.24
69 0.22
70 0.19
71 0.16
72 0.17
73 0.17
74 0.13
75 0.12
76 0.09
77 0.07
78 0.06
79 0.06
80 0.06
81 0.07
82 0.06
83 0.07
84 0.06
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.08
92 0.11
93 0.11
94 0.11
95 0.11
96 0.11
97 0.12
98 0.12
99 0.13
100 0.12
101 0.17
102 0.17
103 0.19
104 0.2
105 0.21
106 0.22
107 0.21
108 0.24
109 0.24
110 0.24
111 0.23
112 0.25
113 0.28
114 0.28
115 0.34
116 0.33
117 0.29
118 0.34
119 0.36
120 0.33
121 0.31
122 0.31
123 0.26
124 0.24
125 0.24
126 0.19
127 0.18
128 0.17
129 0.15
130 0.14
131 0.12
132 0.11
133 0.1
134 0.12
135 0.1
136 0.09
137 0.11
138 0.1
139 0.11
140 0.14
141 0.17
142 0.18
143 0.2
144 0.27
145 0.28
146 0.32
147 0.36
148 0.4
149 0.45
150 0.5
151 0.55
152 0.55
153 0.54
154 0.54
155 0.58
156 0.62
157 0.65
158 0.65
159 0.67
160 0.71
161 0.74
162 0.75
163 0.76
164 0.73
165 0.72
166 0.72
167 0.75
168 0.74
169 0.72
170 0.76
171 0.76
172 0.78
173 0.78
174 0.79
175 0.77
176 0.79
177 0.85