Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NJN1

Protein Details
Accession A0A1Y3NJN1    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
227-247NPETLNKKRDSKRKIKQDSMAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito_nucl 11.666, cyto_nucl 10.833, mito 6.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR023610  PInositol-4-P-5-kinase  
IPR002498  PInositol-4-P-5-kinase_core  
IPR027484  PInositol-4-P-5-kinase_N  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016307  F:phosphatidylinositol phosphate kinase activity  
Pfam View protein in Pfam  
PF01504  PIP5K  
PROSITE View protein in PROSITE  
PS51455  PIPK  
Amino Acid Sequences NELLPSSKYYYKFKDYAPRIFKAIREMYKISSEDYLMSLTGKYMLTEIGSPGKSGSFFYYSQDYRYIIKTVHHTEHKYLLKILRNYYTYLKKNPNTLICKIFGLHRVKIQHGKKIHFIVMENIFPPDKDIHEKYDLKGSLVGRYTNDKGQNANKLIVLKDVNWIKKERKIYLGKEKADLLIKQLEKDVNFLAENNVMDYSLLVGCHNLNKGNKDNIRDSTLSIIEPNPETLNKKRDSKRKIKQDSMAIALARAMAETEPVSLETSNSTLPDFNPKHKKHLIFYHDDGGFRATDENNNELQEIYFLGIIDIFTNYNTKKKMEYLCRSIISDRKNISSVNPTFYAKRFLKFIKNSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.67
4 0.66
5 0.62
6 0.6
7 0.58
8 0.54
9 0.53
10 0.54
11 0.49
12 0.49
13 0.48
14 0.46
15 0.49
16 0.48
17 0.4
18 0.33
19 0.29
20 0.23
21 0.22
22 0.19
23 0.13
24 0.13
25 0.11
26 0.1
27 0.11
28 0.1
29 0.1
30 0.09
31 0.09
32 0.1
33 0.1
34 0.12
35 0.16
36 0.16
37 0.16
38 0.16
39 0.17
40 0.16
41 0.17
42 0.19
43 0.16
44 0.16
45 0.19
46 0.26
47 0.26
48 0.27
49 0.29
50 0.27
51 0.25
52 0.27
53 0.26
54 0.2
55 0.23
56 0.28
57 0.32
58 0.38
59 0.42
60 0.43
61 0.44
62 0.52
63 0.52
64 0.47
65 0.45
66 0.43
67 0.44
68 0.45
69 0.46
70 0.43
71 0.41
72 0.42
73 0.44
74 0.47
75 0.45
76 0.48
77 0.54
78 0.5
79 0.55
80 0.59
81 0.61
82 0.57
83 0.57
84 0.52
85 0.44
86 0.42
87 0.37
88 0.33
89 0.33
90 0.32
91 0.29
92 0.3
93 0.32
94 0.35
95 0.44
96 0.44
97 0.44
98 0.44
99 0.46
100 0.47
101 0.48
102 0.45
103 0.38
104 0.35
105 0.33
106 0.3
107 0.28
108 0.22
109 0.2
110 0.18
111 0.16
112 0.17
113 0.13
114 0.12
115 0.17
116 0.18
117 0.21
118 0.29
119 0.31
120 0.3
121 0.36
122 0.34
123 0.29
124 0.31
125 0.27
126 0.24
127 0.24
128 0.24
129 0.17
130 0.22
131 0.23
132 0.24
133 0.27
134 0.24
135 0.26
136 0.29
137 0.35
138 0.32
139 0.31
140 0.27
141 0.25
142 0.25
143 0.24
144 0.21
145 0.14
146 0.18
147 0.21
148 0.22
149 0.23
150 0.26
151 0.26
152 0.31
153 0.35
154 0.32
155 0.36
156 0.4
157 0.44
158 0.52
159 0.57
160 0.53
161 0.5
162 0.48
163 0.41
164 0.37
165 0.3
166 0.22
167 0.2
168 0.19
169 0.18
170 0.19
171 0.19
172 0.17
173 0.18
174 0.16
175 0.11
176 0.11
177 0.11
178 0.1
179 0.1
180 0.1
181 0.09
182 0.08
183 0.07
184 0.07
185 0.06
186 0.06
187 0.05
188 0.05
189 0.05
190 0.05
191 0.06
192 0.08
193 0.09
194 0.12
195 0.14
196 0.17
197 0.22
198 0.29
199 0.32
200 0.34
201 0.38
202 0.36
203 0.39
204 0.35
205 0.32
206 0.27
207 0.25
208 0.21
209 0.18
210 0.16
211 0.13
212 0.13
213 0.13
214 0.11
215 0.12
216 0.16
217 0.21
218 0.28
219 0.31
220 0.39
221 0.46
222 0.55
223 0.63
224 0.7
225 0.74
226 0.78
227 0.82
228 0.81
229 0.79
230 0.78
231 0.72
232 0.65
233 0.57
234 0.46
235 0.37
236 0.29
237 0.23
238 0.15
239 0.11
240 0.07
241 0.04
242 0.05
243 0.05
244 0.06
245 0.06
246 0.07
247 0.08
248 0.07
249 0.08
250 0.08
251 0.09
252 0.09
253 0.09
254 0.1
255 0.1
256 0.1
257 0.21
258 0.22
259 0.3
260 0.41
261 0.42
262 0.5
263 0.57
264 0.61
265 0.57
266 0.64
267 0.62
268 0.59
269 0.6
270 0.6
271 0.54
272 0.49
273 0.43
274 0.35
275 0.28
276 0.21
277 0.2
278 0.13
279 0.16
280 0.19
281 0.22
282 0.22
283 0.22
284 0.22
285 0.2
286 0.19
287 0.15
288 0.12
289 0.09
290 0.08
291 0.07
292 0.07
293 0.07
294 0.07
295 0.07
296 0.08
297 0.07
298 0.07
299 0.12
300 0.14
301 0.2
302 0.22
303 0.23
304 0.25
305 0.33
306 0.42
307 0.48
308 0.55
309 0.57
310 0.62
311 0.63
312 0.63
313 0.61
314 0.58
315 0.53
316 0.51
317 0.47
318 0.44
319 0.43
320 0.41
321 0.4
322 0.44
323 0.41
324 0.39
325 0.39
326 0.38
327 0.4
328 0.41
329 0.46
330 0.39
331 0.39
332 0.4
333 0.43
334 0.5